KEGG   Azotobacter vinelandii DJ: Avin_36240
Entry
Avin_36240        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avn  Azotobacter vinelandii DJ
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACO79771
UniProt: C1DRB3
Position
3688235..3688891
AA seq 218 aa
MSYRKRVDAQQAHILSLRLALGLMTLLSLALAYGWWKAPQELTIHVPPDLRSGSTRKWWE
VPPESVYSFALYIFQQMNRWPKDGEVDYQDNIHRLDAYLTPACKAYLQKDYELRRNAGEL
RKRERGVFEIPGRGIGDAGEQRTLVHSINDWTVNLDMAADEHYGGERVKRALARYPLHIV
RADVDPEQNPFGLQWDCYGGNPQRIEIELDTAVTGGRP
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagctatcggaaacgggtcgacgcccagcaggcgcacattctcagcctgcgcctggcc
ctggggctcatgaccctcctgagcctggcgctcgcctacggctggtggaaagccccgcag
gagctgaccatccacgtcccgccggacctgcgctcgggcagcacgcgcaagtggtgggag
gttccaccggagagcgtctacagtttcgccctctacatcttccagcagatgaaccgctgg
ccgaaagatggcgaggtcgactaccaggacaacatccatcgactggatgcctacctcacc
cccgcctgcaaggcctacctgcagaaggactacgaactgcggcgcaacgccggggagttg
cgcaagcgtgaacgcggcgtattcgagattcccggccggggcatcggcgacgcgggcgaa
caacgcaccctcgtgcacagcatcaacgactggacggtcaacctcgacatggccgccgac
gagcattacggcggcgagcgcgtgaagcgcgcgctcgcgcgctacccgctgcatatcgtt
cgtgccgatgtcgatcccgagcaaaacccgttcggcctgcagtgggactgctacggcgga
aacccgcagcgcatcgagatcgagctggatacggccgtcacgggaggccgtccatga

DBGET integrated database retrieval system