KEGG   Azotobacter vinelandii DJ: Avin_36280
Entry
Avin_36280        CDS       T00885                                 
Name
(GenBank) lipoprotein
Organism
avn  Azotobacter vinelandii DJ
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 DUF87 AAA_10 AAA_16 FtsK_SpoIIIE ATPase_2
Other DBs
NCBI-ProteinID: ACO79775
UniProt: C1DRB7
Position
3691703..3694624
AA seq 973 aa
MGLFERFRGRARMAEKVEPEVQIADVAQESHEAHEAHEAPDIERIEAATERHLERLTRLG
IPDPTDWRDPGKRPATQADVARLYEVAPSFVDLLPWVEYLPDEQAMLLEDGHSWAAFFEL
TPIGTEGRDPAWLRMVRDALENALQDSFDELDSSPWVVQMYAQDETNFDDYLQSLRNYIQ
PRAAGSDFTEVYLALFKRHLEAIAKPGGLFEDTAVSQLPWRGQQRRVRLVVYRRVQVSDM
VVRGQAPAPYLAVICDRLVGALANAGVVARRMDGQAVRTWLVHWFNPRPDHLGATDADIR
RFLELVCQAPEGLSEDDLPLASGTDFAQNLFYREPQSSTPKGLWYFDAMPHRVVVVDRLR
DAPKTGHLTGETRKSDAYNALFDRLPEDTVLCLTMVATPQDLLEGHLEQLSKKAVGDTQA
SIHTRDDVEHVRTLLGRKHKLYRGNLAFYLRGTDHRQLDERTTQLSNALLGAGMSPVQPQ
DEVAPLNSYLRWLPCNFDPNERHALDWYVQFMFVQHIANLAPIWGRSTGTGHPGVTLFNR
GGAPVTFDPLNRLDRQMNAHLFIFGPTGSGKSASATNILSQVIAIYRPRLFIVEAGNSFG
LLGEFAKNLGLSVNRARLAPGSGVNLAPFADAIKLIEAPGKTKVLDMEASDDHLADTEDE
QRDILGEMEITARLMVTGGEAKEDARLTRADRSALRQCILDAAKTCSEQGKTVLPEDVRD
ALRRMAADEKILEPRRNRLMEMAEAMSMFCMGAEGEMFNRPGSPWPEADLTIVDLATYAR
EGYEAQMAIAYISLLNTVNNIAERDQFKGRPLIFFTDEGHIQLKVPLLSPYAVKITKMWR
KLGAWFWMATQNVDDVPPEASALLNMIEWWICLNMPPDEVEKIARFRELTPAQKAMMLSA
RKENGKFTEGVVLAKRLELLFRVVPPSLYLALAMTEPEEKKQRYDIMMAKGCDELGAALE
VAADLDRKRGITS
NT seq 2922 nt   +upstreamnt  +downstreamnt
atgggcctcttcgaacgattccgcggccgcgcccggatggcggagaaagtcgagcccgag
gtccagatcgccgacgtcgctcaagagagtcatgaggctcatgaggctcatgaggctccc
gacatcgagaggatcgaagccgccaccgagcgccatctcgaacggctgacccgcctcggc
atccccgatccgacggactggcgagatcccggcaaacgcccggcgacccaggcggacgtc
gccaggctctacgaggtggcgccctccttcgtcgacctgttgccctgggtggaatacctg
ccggacgagcaggcgatgctcctcgaggacggccattcgtgggcagccttcttcgaactg
acgccgatcggcaccgaagggcgcgacccggcctggctgcggatggttcgggacgccctg
gaaaacgccctgcaggacagtttcgatgaactcgacagctcgccgtgggtggtacagatg
tatgcccaggacgaaaccaacttcgacgattacctgcagtccctgcgcaactacatccag
cccagggccgcggggagcgacttcaccgaggtctacctggcgttgttcaagcggcatctg
gaggcgatcgccaagcccggcggattgttcgaagacacggccgtcagccagttgccctgg
cgcggccagcagcgccgggtccgcctggtggtctaccgccgcgtccaggtatcggacatg
gtcgtgcgtggccaggcgcccgccccctatctcgcggtgatctgcgatcgcctggtcggt
gccctggccaacgccggcgtggtcgccagacgcatggatggccaggccgtgcgcacctgg
ctcgtccactggttcaatccccgccccgaccacctgggcgcgacggatgccgacatccgc
cgcttcctcgaactggtctgccaagccccggagggactctccgaagacgacttgccgctg
gccagcggcaccgacttcgcccagaacctcttctaccgggaaccgcagtccagcacgccc
aaagggctctggtatttcgatgcgatgccgcatcgcgtggtggtcgtcgaccggctgcgc
gatgcgccgaagaccggccacctgaccggcgagacccgcaagagcgatgcctacaacgcc
ctgttcgaccgcctgccggaagacaccgtgctctgcctcacgatggtcgccacgccccag
gacctgctggaaggccacctggaacagctctcgaagaaagcggtgggcgatacgcaggcc
tcgatccacacgcgcgacgatgtggagcacgtccgcacactgctcggccgcaagcacaag
ctctatcgggggaacctcgccttctatctgcgggggacagaccacaggcagctcgacgaa
cggaccacccagctcagcaacgccctgctcggtgccggcatgtcgccggtccagccgcag
gacgaggtcgccccgctgaacagttacctgcgctggctgccctgcaacttcgaccccaac
gagcggcatgccctggactggtacgtccagttcatgttcgtccagcacatcgcgaatctg
gcaccgatctggggacgctcgacgggcaccggccaccccggtgtcaccctgttcaaccgc
ggtggcgcgccggtcaccttcgacccgctgaaccgcctcgatcgccagatgaatgcccac
ctgttcatcttcggtccgaccggctcgggcaaatcggcttcggcgaccaacatcctcagc
caggtcatcgcgatctaccggcctcgcctgttcatcgtcgaggcgggcaacagcttcggc
ctgctgggcgagttcgcgaaaaacctggggctcagcgtgaaccgcgcgcgtctcgctccc
ggttcgggcgtcaacctggcgcccttcgccgatgcgatcaagctcatcgaagcccccggc
aagacgaaggtcctggacatggaggcctccgacgatcacctggccgacaccgaggacgag
cagcgggacatcctcggcgagatggaaatcaccgcccgcctgatggtcaccggcggggag
gcgaaagaggacgcgcgactgacgcgcgccgaccgcagcgccctgcgccagtgcatcctg
gacgcggccaagacctgctccgagcagggaaagaccgtcctcccggaggatgtgcgcgat
gctctgcgccgcatggcggccgacgagaaaatacttgaaccccggcgcaatcgcctgatg
gaaatggccgaggccatgtccatgttctgcatgggcgccgaaggcgaaatgttcaaccgg
ccgggcagcccctggcccgaggcggacctcaccatcgtcgacctggcgacctacgcccgc
gaaggctacgaagcgcagatggccatcgcctacatctcgctgctcaacacggtgaacaac
atcgccgagcgcgaccagttcaaggggcggccgctgatcttcttcaccgacgaaggccac
atccagctcaaggtgccgctgctctctccctacgcggtcaagatcaccaagatgtggcgc
aagctcggcgcctggttctggatggccacccagaacgtggacgacgtccccccggaggcc
tccgccctgctgaacatgatcgagtggtggatctgcctgaacatgccgccggacgaggtg
gagaagatcgccaggttccgcgaactgacgccggcgcagaaggcgatgatgctctcggcc
cgcaaggagaacggcaagttcaccgaaggcgtcgtgctcgccaagcgcctcgaactgctg
ttccgggtggttccgcccagcctgtacctggcgctcgcgatgaccgagccggaagaaaaa
aagcagcgctacgacatcatgatggccaagggctgcgacgaactcggcgccgccctggaa
gtcgccgccgacctggaccgcaaacgcggcatcacctcctga

DBGET integrated database retrieval system