KEGG   Azotobacter vinelandii DJ: Avin_36350
Entry
Avin_36350        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avn  Azotobacter vinelandii DJ
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ACO79782
UniProt: C1DRC4
Position
3699059..3699991
AA seq 310 aa
MKRSPLRPLALAIATTLPVGTSVALDTAAIVASTLSPDCLEYKVVGICYWLYCSAGCRVR
TSTKVRHYIPDAVVSAYANTGDNPWSEVSALGAPNVAAQAGNDGTTNHGNENNLAKFKEA
DVIGHPGGAVFSRFASASGYACRGATSPLVPYLLSTLDSLAWRHGVPESVYPEALVPGMR
EVGGTLSGDLWGSVYPRSGFLHQTDDHKAGAVFAQRAGDITTRQGQPHVYLPMLAHPQDG
YWPAGELLEGNARTGKWQELTPRLSQSCAVFPNGGSHAQAADGAYAWALWRPYACCQRRG
QRFLGSTDVQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaaacgctcaccgctgcgtcccctggccctggcgatcgccacgaccctgccggtcggc
acctcggtcgcgctcgataccgccgccatcgtcgcctcgacgctgtcgcccgactgcctg
gaatacaaggtggtcggcatctgctactggctgtactgctcggccggctgccgggtgcgc
acttcgacgaaggtgcgccactacattcccgacgccgtggtgtccgcctacgccaacacc
ggcgacaacccctggagcgaggtcagcgccctgggcgccccgaacgtcgcagcccaagcg
ggcaacgacgggaccacgaaccacggcaacgagaacaacctcgccaagttcaaggaggcc
gacgtcatcggccatccgggcggcgcggtcttcagccgcttcgccagtgcctccggctac
gcctgccggggcgcgaccagcccgctcgtcccgtacctgctgagcacactggacagcctc
gcctggcgccatggcgttcccgagtcggtctacccggaggcgctggtccccgggatgcgc
gaggtgggcggcacgctctccggcgacctgtggggcagcgtctatccccgtagcggcttc
ctgcaccagaccgacgaccacaaggccggggcggtcttcgcccagcgtgccggcgacatc
accacgcgccaggggcaaccgcacgtctacctgccgatgctggcccatccccaggacggc
tattggcccgccggcgagttgctcgagggcaatgcccgcaccgggaaatggcaggagctg
accccgcgcctcagccagagctgcgcggtgttccccaacggcggcagccacgcccaggcc
gcggacggggcctatgcctgggcgctctggcgcccctacgcctgctgccagcggcgcggc
cagcgctttctgggtagcacggacgtccaatga

DBGET integrated database retrieval system