KEGG   Azotobacter vinelandii DJ: Avin_41750Help
Entry
Avin_41750        CDS       T00885                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase,acetoin dehydrogeanse E2 component, AcoC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn00020  Citrate cycle (TCA cycle)
avn00620  Pyruvate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
Module
avn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_41750 (acoC)
   00020 Citrate cycle (TCA cycle)
    Avin_41750 (acoC)
   00620 Pyruvate metabolism
    Avin_41750 (acoC)
Enzymes [BR:avn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Avin_41750 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Thioesterase Esterase GCV_H Abhydrolase_5 PGAP1 Ndr
Motif
Other DBs
NCBI-ProteinID: ACO80305
UniProt: C1DEX6
Position
4208067..4209179
Genome map
AA seq 370 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGKVNAWLKEEGASIAKGDDVLDVETDKISSSVEAPFSGVLRR
IVAKEDETLPVGALLAVVVEGEASEAEIDAVVQRFQDEFVPGGEDEEASGPAPQKVELDG
RVIRFLDRGEGGIPLLLVHGFGGDLNNWLFNHEALAADRRVIALDLPGHGESGKTLKSGD
LDELSRAVLALLDHLDIPRAHLAGHSMGGAVSLNLARLAPERVVSLSLICSAGLGAEING
DYLNGFVEASSRNALKPQLVQLFSDPALVTRQLLEDMLKYKRLEGVDAALRQLVERLSAG
GRQQIDLRSVLEQGRHPALLIWGSDDAIIPAAHAQGLPVQVEILPGQAHMVQMEAADEVN
KLILAFLAKH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccataccctgaccatgccgaagtggggtctctcgatgaccgagggcaag
gtcaacgcctggctcaaggaagaaggcgccagcatcgccaagggcgacgacgtgctcgac
gtggaaaccgacaagatttcaagcagcgtcgaggcgcccttctccggcgtgttgcggcgc
atcgtcgccaaggaagacgaaaccttgccggtcggcgccctgctcgccgtggtggtggaa
ggcgaggcctccgaggcggagatcgacgccgtggtgcagcgcttccaggacgagttcgtc
cccggcggcgaagacgaggaagccagcggcccggcgccgcagaaggtcgagctggacggc
cgcgtcatccgcttcctcgaccgcggcgagggcggcatcccgctgctgctggtccacggt
ttcggcggcgacctgaacaactggctgttcaaccacgaggcgctggccgccgaccgccgg
gtgatcgccctcgacctgccgggccacggcgagtcgggcaagacgctgaagagcggcgac
ctcgacgagttgagccgggccgtgctggccctgctcgaccatctggacatcccgcgcgcg
cacctcgccggccactcgatgggcggcgcggtgtcgctgaacctggcgcgcctggcgccc
gagcgggtggtttcgctgagcctgatctgcagcgccggcctcggcgcggagatcaacggc
gactacctcaacggcttcgtcgaggcgagcagccgcaacgccctcaagccgcaactggtg
caactgttctccgaccccgcgctggtcacccggcaactgttggaggacatgctcaagtac
aagcgcctggaaggcgtcgacgcggcactgcgccaactggtcgaacggctgtccgcgggc
ggccgccaacagatcgacctgcgcagcgtgctggaacagggccgccatccggcgctgctg
atctggggcagcgacgacgccatcatccccgccgcccatgcccagggcctgccggtccaa
gtggaaatcctgcccggccaggcgcacatggtgcagatggaagcggccgacgaggtcaac
aagctgatcctggccttcctcgccaagcactga

DBGET integrated database retrieval system