KEGG   Azotobacter vinelandii DJ: Avin_42520Help
Entry
Avin_42520        CDS       T00885                                 

Gene name
ilvI
Definition
(GenBank) Acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00290  Valine, leucine and isoleucine biosynthesis
avn00650  Butanoate metabolism
avn00660  C5-Branched dibasic acid metabolism
avn00770  Pantothenate and CoA biosynthesis
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01130  Biosynthesis of antibiotics
avn01210  2-Oxocarboxylic acid metabolism
avn01230  Biosynthesis of amino acids
Module
avn_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
avn_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:avn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Avin_42520 (ilvI)
   00660 C5-Branched dibasic acid metabolism
    Avin_42520 (ilvI)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Avin_42520 (ilvI)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Avin_42520 (ilvI)
Enzymes [BR:avn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Avin_42520 (ilvI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N PPS_PS
Motif
Other DBs
NCBI-ProteinID: ACO80375
UniProt: C1DFH9
Position
complement(4283900..4285624)
Genome map
AA seq 574 aa AA seqDB search
MELLSGAEMVVRFLRDEGVKYIYGYPGGALLHIYDALFKEKEVTHILVRHEQAATHMADG
YARATGKAGVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVPSNMVGSDAFQETDMIG
VSRPIVKHSFIVKHPSEIPEVLKKAFYIAESGRPGPVVVDIPKDMGDPSQKYEYVYPKKV
KLRSYSPAQRGHSGQIRKAVEMLLAAKRPVLYSGGGVIMGRAAAQLTELAQMLNLPVTNT
LMGLGGYPGNDRQFLGMLGMHGSYTANLAMHHSDVILAIGARFDDRVVNGPAKFCPNAKI
IHVDIDPASISKTIKADVPIVGPVDSVLAEMISIVKEIGAMPQKEVVASWWKQIEEWRGT
RGLFPYDKGDGSIIKPQTVIETLYEVTKGDAYVASDVGQHQMFAAQYYRYAKPNRWINSG
GLGTMGFGFPAAMGVKLNFPEADVACITGEGSIQMNIQEMSTCMQYDLPVKIVNLNNGAL
GMVRQWQDMQYSSRYSHSYMESLPDFVKLAEAYGHVGMRITELKDLKPKLEEAFALKDRL
VFLDIAVDTSEHVYPMQIRDGAMRDMWLSKTERT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttttatccggcgctgaaatggtagtccgcttcttgcgcgacgaaggcgttaaa
tacatctacggatatccgggcggtgcccttctgcacatctacgatgccctgttcaaggaa
aaggaagtcacccatatcctggttcgtcacgagcaggcggccacccacatggccgatggc
tatgctcgcgccaccggcaaggccggcgtcgtgctggtgacctccgggcccggtgcgacc
aacgccatcaccggcatcgccaccgcctacatggactccatcccgatggtggtgatttcc
gggcaagtgccgagcaacatggtcggcagcgacgctttccaggagaccgacatgatcggt
gtctcccgtccgatcgtgaagcacagcttcatcgtcaagcatccttcggaaatccccgaa
gtgctgaaaaaggctttctatatcgccgagtccggccgtcccggtccggtggtggtggat
attccgaaggacatgggcgatccgtcccagaagtacgaatacgtctatccgaagaaggtc
aagctgcgctcctacagccctgctcagcgtggccattccgggcagatccgcaaggctgtc
gagatgctcctggccgccaagcgtcccgtactctattccggcggtggagtgatcatgggc
agggccgccgcccagttgaccgaactggcgcagatgctcaacctgccggtgaccaatacc
ctgatgggcttgggcggctatccgggcaacgaccggcagttcctcggcatgctcggcatg
cacggcagctataccgccaacctggccatgcatcattccgatgtgatcctggccatcggc
gcgcgtttcgatgatcgggttgtcaacgggcccgccaagttctgcccgaatgccaagatc
attcatgtcgatatcgatccggcctcgatttccaaaaccatcaaggccgatgtgccgatc
gtgggccccgtcgacagcgtgctcgctgaaatgatctccatcgtcaaggagattggcgcg
atgccgcagaaggaggtcgtggccagttggtggaagcagatcgaggagtggcgcggtacg
cgtggtctgtttccctacgacaagggcgacggcagcatcatcaagccgcagacggtgatc
gagaccctgtacgaggtgaccaagggggatgcctatgtcgcttccgacgtggggcagcac
cagatgttcgccgcccaatactacaggtacgccaagccgaatcgttggatcaactccggt
ggcctgggtaccatgggcttcggcttccccgcagccatgggcgtcaagctgaatttcccc
gaggccgatgtggcctgtatcaccggggagggcagcatccagatgaacattcaggaaatg
tcgacctgcatgcagtacgacctaccggtcaagatcgtcaacctcaacaacggcgcgctg
ggcatggttcgccagtggcaagacatgcagtacagcagccgctattcgcattcatacatg
gagtcgttgcccgatttcgtcaagctggccgaggcttatggccatgtcggtatgcgtatc
accgagttgaaggacctcaagccgaagctggaggaagccttcgctctgaaagaccgtttg
gtgttcctcgacatcgcggtggataccagcgagcacgtctatccgatgcaaatcagagat
ggtgcaatgcgcgacatgtggctgagcaagacggagcggacctga

DBGET integrated database retrieval system