KEGG   Azotobacter vinelandii DJ: Avin_50780
Entry
Avin_50780        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avn02044]
    Avin_50780
Secretion system [BR:avn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Avin_50780
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ACO81165
UniProt: C1DM88
Position
complement(5147205..5148530)
AA seq 441 aa
MSVLPEAVCWHEGMQLLPQHFQLQGLRAEALAGHLARVCNPWFWGVETLEVDPAALCAGR
VRVTALEATLPDGLPVGLSADGGAPLELDLAEAFADSAAGVTVYLAVTPLGRAGQLLPLN
GRLRSVVGDALPDLASGEHPEPIVVWRPNPRLVTAEGRADSVCIPLLRVGREGGGYVRLP
YVAPMPRILPESPLGEKVRALCARAREKCLFLAGRLRQARQAGNAEDAAELRLQLAALWA
RLPEVEAALNGRGTDPATLHRLLAGMAGAWCALDPLAGVPAFRPLEFEDLLRGYDEVLGW
LAATLARIRAGYRSLPFEQDRHGFHILLPDRERPGQRLAIGLRMPAGTGEQAARDWLAQA
IVASEAHVATLVRQRMGGLSWHPMPRQEQVAYGVGEDTRIFVLKAAGEWFDPSQALRIVP
CGGAAGGQPWQIVLFADAGDR
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgagtgttctacccgaggcggtctgctggcacgagggcatgcagttgctgccccagcat
ttccagctccagggcttgcgcgcggaagccctggcgggacacctggccagggtctgcaat
ccctggttctggggcgtcgagacgctggaggtcgatcctgccgccctctgtgccggtcgg
gtgcgggtgaccgccctcgaagccaccctgccggacggcctgccggtcggcctgagcgcc
gacggcggtgcgccgctggaactggatctggccgaggcgttcgccgactcggccgccggc
gtgaccgtctacctcgccgtgacgccgctgggacgggccggccagttgctgccgctgaac
ggacgcctgcgctcggtggtcggtgacgcgctgcccgatctggccagcggcgagcatccc
gagccgatcgtcgtctggcggccgaatccgcgcctggtcaccgccgaaggacgggccgac
tcggtgtgcattcccctgctgcgagtggggcgggagggcggcggctatgttcgtttgccc
tatgtcgccccgatgccgcgcatcctcccggagtcgccgctgggcgaaaaggtgcgggcc
ctgtgcgcccgcgcccgggagaagtgcctgttcctcgccgggcggctgcgccaggcccgg
caggccggcaacgccgaagacgccgccgagcttcgcctgcaactggcggccctgtgggcg
cgactgcccgaggtggaggcggccttgaacggacgcggcaccgatccggcgaccctgcac
cggctgctggccggcatggccggcgcctggtgcgcgctcgatccgttggccggcgtcccg
gcgttccgtcccctggagttcgaggacctgctgcgcggctacgacgaggtgctcggctgg
ctggcggcgacgctggcgcggatccgcgcgggctaccggagcctgccgttcgagcaggac
cggcatggcttccatatcctcctgccggatcgggagcggcccggccagcgcctggcgatc
ggcctgcgcatgccggccgggaccggcgagcaggcggcccgggactggctggcgcaagcc
atcgtcgcttccgaggcgcatgtcgcgactctggttcgccagcgcatgggcgggctttcc
tggcatcccatgccccggcaggaacaggtcgcctacggggtcggcgaggacacgcggatc
ttcgtgctcaaggcggccggcgagtggttcgatccgagccaggcgctgcgcatcgtgccc
tgcggcggcgcggccggcggccagccctggcagatcgtgctgttcgccgacgccggcgac
cgctag

DBGET integrated database retrieval system