KEGG   Azotobacter vinelandii DJ: Avin_50800
Entry
Avin_50800        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avn02044]
    Avin_50800
Secretion system [BR:avn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Avin_50800
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACO81167
UniProt: C1DM90
Position
5149261..5149824
AA seq 187 aa
MAESTQHKLDRIRPPRVQITYDVETGNAIEKKELPLVVGILADLSGKPEKPLPKLMERRF
VEINRDNFNDVLASIAPRAALQVDNTLSQDGSKLNIELHFDHIDDFDPVNIVRQVTPLRR
LFEARQRLRDLLTKLDGNDDLDKLLQDVVANTEGLQEIRSARPQAENPAGAPGAEPAADE
PAAEPQA
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccgagagtacgcagcacaagctcgacaggattcgtccgccccgcgtgcagatcacg
tacgacgtggaaaccgggaacgccatcgagaaaaaggaactcccgctggtggtcggcatc
ctcgccgacctctccggcaagccggaaaagcctctgcccaagctgatggaacggcgcttc
gtcgagatcaatcgcgacaacttcaacgacgtcctcgcctccatcgctccccgcgccgcc
ctgcaggtcgacaacaccctgagccaggacggcagcaagctgaacatcgaactgcatttc
gaccacatcgacgacttcgatccggtcaacatcgtccggcaggtgaccccgctgcgccgg
ctgttcgaggcgcgccagcgcctgcgcgacctgctcaccaagctcgacggcaacgacgac
ctggacaagctgctgcaggacgtcgtggccaacaccgaagggctgcaggagatcaggtcg
gcccgtccgcaggccgagaacccggcgggcgcgcccggcgccgagccggccgccgacgaa
ccggcagcggaaccgcaagcctga

DBGET integrated database retrieval system