KEGG   Aeromonas veronii TH0426: AMS64_05385Help
Entry
AMS64_05385       CDS       T04529                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00010  Glycolysis / Gluconeogenesis
avo00030  Pentose phosphate pathway
avo00051  Fructose and mannose metabolism
avo00680  Methane metabolism
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
avo01120  Microbial metabolism in diverse environments
avo01130  Biosynthesis of antibiotics
avo01200  Carbon metabolism
avo01230  Biosynthesis of amino acids
Module
avo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
avo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMS64_05385
   00030 Pentose phosphate pathway
    AMS64_05385
   00051 Fructose and mannose metabolism
    AMS64_05385
  09102 Energy metabolism
   00680 Methane metabolism
    AMS64_05385
Enzymes [BR:avo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     AMS64_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AMQ41861
UniProt: A0A142E123
Position
1141095..1142174
Genome map
AA seq 359 aa AA seqDB search
MSKKIFDFVKPGVITGDDVQKVFAIAKENGFALPAVNCVGTDSVNAVLEAAAKVKAPVIV
QFSNGGAVFTAGKGLKLEGQKAAILGAISGAKHVHAVAEAYGVPVILHTDHAAKKLLPWI
DGLLEAGEKHFAETGKPLFSSHMLDLSEESLEENIDICCEYLTRMAKMNMTLELELGCTG
GEEDGVDNSHMDQSALYTQPEDVAYAYERLSKISPRFTIAASFGNVHGVYKPGNVKLTPS
ILDASQKYVSEKFGIPAKSLDFVFHGGSGSTLEEIRESISYGVVKMNIDTDTQWATWEGL
LNFYKKNEAYLQGQLGNPEGADKPNKKYYDPRVWLREGQTSMIARLEKAFSDLNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaaaattttcgacttcgtaaaacccggcgtgatcactggtgatgacgttcag
aaagtgttcgccatcgctaaagagaacggcttcgctctgccggccgtaaactgcgttggt
accgactcagtgaacgcagtactggaagctgccgccaaggttaaagcgccggttatcgtt
cagttctccaacggtggtgccgtgttcaccgccggtaagggtctgaagctggaaggtcag
aaagctgccatcctgggtgccatctctggtgccaagcacgttcacgctgttgccgaagct
tacggcgtgccggtaatcctgcacaccgaccacgctgccaagaagctgctgccgtggatc
gacggtctgctggaagcgggcgagaagcactttgctgaaaccggcaagccgctgttctcc
tcccacatgctggatctgtccgaagagtctctggaagagaacatcgacatctgctgcgag
tacctgacccgcatggccaagatgaacatgactctggagctggaactgggttgcaccggt
ggcgaagaagacggcgtcgacaacagccacatggatcagtccgctctgtacacccagccg
gaagatgttgcttacgcttacgagcgtctgtctaagatcagcccgcgtttcaccatcgct
gcctccttcggtaacgtacacggtgtatacaagccgggtaacgtcaagctgaccccgtcc
atcctggacgcttcccagaagtacgtttccgagaagttcggtattccggccaagtctctg
gacttcgtattccacggtggttcaggttccactctggaagagatccgcgagtccatctcc
tacggcgtagtgaagatgaacatcgacaccgacacccagtgggcaacctgggaaggtctg
ctgaacttctacaagaagaacgaagcttacctgcaaggccagctgggcaacccggaaggc
gccgacaagccgaacaagaagtactacgatccgcgcgtatggctgcgtgaaggtcagact
tccatgatcgctcgtctggagaaagcattctccgacctgaacgccatcgacgtactgtaa

DBGET integrated database retrieval system