KEGG   Aeromonas veronii TH0426: AMS64_08000Help
Entry
AMS64_08000       CDS       T04529                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00360  Phenylalanine metabolism
avo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avo00790  Folate biosynthesis
avo01100  Metabolic pathways
avo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AMS64_08000 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMS64_08000 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMS64_08000 (phhA)
Enzymes [BR:avo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AMS64_08000 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AMQ42320
UniProt: A0A2S3XM70
Position
1688284..1689078
Genome map
AA seq 264 aa AA seqDB search
MATFYTAHQPDADGVIHYSNEEHGTWQILIERQFAALDGKGCDEYLAGLDRLGLPRDRIP
QLAEINSVLQPATGWSVAAVPALISFDRFFALLANRQFPVATFIRRRDELDYLQEPDVFH
EIFGHCAMLTNPAFAHFTQLYGQLGQQASKEQRVFLARLYWFTVEFGLLATPDGLRIYGG
GIISSIGETAYALSGQPLLQPFDLLTVLRTPYRIDIMQPTYFVLPSLDHLYQLTGEEIMA
ALAEASRLGLYPPRFEVAAGKQAS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccttctacaccgcccaccagccggatgctgacggggtgatccactacagcaac
gaagagcacggcacctggcagatcctgatcgaacgccagttcgctgccctcgatggcaag
gggtgtgacgagtatctggccggtctcgacagactgggattgccccgtgatcgcatcccc
cagctggccgagatcaactccgtcttgcagcctgcgaccggctggtcggtggcggcggtg
cctgcgcttatctcgttcgatcgcttcttcgccctgctagccaaccgccagtttccggta
gcgacctttatccggcgccgggacgagctcgactacctgcaagagccggatgtctttcac
gagatcttcggccactgcgccatgctgaccaatccggcctttgcccacttcacccaactc
tacggtcagttggggcagcaggcgagcaaggagcagcgagtttttctggcgcggctctac
tggttcaccgtggagtttggcctcttggctacacctgacgggctgcgtatctacggtggc
ggcattatctcctccatcggcgagaccgcctatgccctctccggccagccgctgctgcaa
cctttcgatctgttgaccgtgctgcgcactccctatcgtatcgacatcatgcagcccacc
tattttgtgctgccgagtctcgatcatctctaccagctgaccggtgaggagatcatggct
gctctggcggaggccagtcggcttggcctctatccgccacgttttgaggttgccgctggc
aaacaggcgagctga

DBGET integrated database retrieval system