KEGG   Aeromonas veronii TH0426: AMS64_09025
Entry
AMS64_09025       CDS       T04529                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00230  Purine metabolism
avo01100  Metabolic pathways
avo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AMS64_09025
Enzymes [BR:avo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AMS64_09025
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AMQ42502
UniProt: A0A2S3XQ82
Position
1923818..1926136
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSNIAHGKVLAIDATEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDEAKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAQSALADDAYPIHPSGNLLRQSQLRANDPEQAIAAADLQFQGH
YRTPVVQHCHLETVTCYAYMDQPDHIIVVSSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGKMGLNRDGT
LKGYQLDVLSNTGGYASHGHSIASAGGNKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVIFALECMLDDACAELGLDPLDVRIANVAREGDVNQVNQKTIYSAGLPDCLLRGREM
FEWDRLKAECLGQDPACRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPEKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRIINLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGSGEEQHHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctataccgatgacaacatcatgctcgggatgcgccacgccaagtacgtgcgaagcaat
attgcccacggcaaggtgcttgccatcgatgcgaccgaggcactggccctgcacggggtc
gaagccgtgtttacccatgaagatgtccccaccacctgctttcgcactgccggtcacgcc
tggtccctcgatgaggccaaacgggacgtgaaagaccggcgtctgctcaccgaccatgta
cgccacttcggcgatggggtcgccatagtcgtggcgcgcgatccgctggtcgccgagaag
gctgccgccctggtcaaggtgacttacgagccgctgccggtgatgacggatgcccaaagc
gcgctggccgacgatgcctatcccattcacccgagcggcaatctgctgcgccaaagtcag
cttcgcgccaatgacccggagcaggccattgcggcggcagatctgcagtttcaggggcac
taccggacgccggtggtgcagcactgccatctggagacggtgacctgctacgcctacatg
gatcagccggaccacatcatcgtagtcagcagcacccagatcccccagatagtgcgcagc
cgggtggctaaatccctcggcctgccctggtcgagcgtgcgggtgatcaagccctatatg
ggcggtggttttggcaacaagcaggatgtgctggaagagccgatggcggcctttttgagc
tacaagcttggcggcgtgccggtcaaggttaccttgagccgggaggagtgtttttttgcc
tcccgcacccgtcacggttttgccatcgatggcaagatgggcctcaaccgcgacggcacc
ctcaagggctatcagctcgacgtgctctccaacaccggcggctatgcctcccacggccac
tccatcgccagtgccgggggcaacaagatcagctacctctatccgcgcagcgccttcggt
tatgacgccaagaccttctacagcaacctgcccaccgctggtgccatgcgcggttacggc
gcgccgcaggtgatttttgccctcgagtgcatgctggatgatgcctgcgccgaactgggg
ctggatccgctcgatgtgcggatcgccaacgtggcgcgcgagggggatgtcaatcaggtc
aaccagaagaccatctacagcgccgggttgccggactgtctgctgcgtggtcgcgagatg
ttcgagtgggatcggctcaaggccgagtgtctggggcaggatcctgcctgccgggtgcgg
cgcggcatcggggttgcgtgctttagctacggctccaacacctatccggtgggggtcgaa
attgccggcgcccgcatgctgctcaatcaggatggcaccgtcaatctgcagatcggcgcc
accgagatagggcaggggtcggacactgtctttgcccagatggcggcccagacgttaggc
attccgtttgagcagatccgggttatctcgactcaggataccgacatcaccgcctatgat
cctggctcgttcgcctcgcgtcagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagttgcgggcccgcattttgtcgctggcggcccaactctgccatcaggatgtgggg
tcattgactctgatcgacggttacgtggtgctggccggtgcgccggagaaggtgttgatc
agcgtcgccgaggtgtcggtcaacgcctactaccacctcactatcggcggtcagatcacc
tccgaggtctcccacaagaccaccaccaacccgcccagtttcggatgcacgtttgtcgat
ctcagcgttgatatcgatctctgcaaggtgaccatcaatcgcatcatcaacctgcacgat
gcaggcaagatcctcaacccgcagctggcggaggggcaggtgcacggcggcatggggatg
gggatcggctggtccctgttcgaggagatgatcatcgacgccaaaaccggcgtggtacgc
aaccccaacctgctcgactacaagttccctaccatgctggatttgcccgaacttgaatgc
gacttcgtgcagacctacgagccccagtcggtctatggccacaaatccctgggggaaccg
cccattatctcgccgggcccggcgatccgtaacgccattcgcatggcgaccggggtggcc
atcaacgagctgcctatcacccccaaaaccctgttccgggagtttgtcgcggcgggtttg
attggcgagggatcaggggaggagcaacaccatgtttga

DBGET integrated database retrieval system