KEGG   Aeromonas veronii TH0426: AMS64_09035
Entry
AMS64_09035       CDS       T04529                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00230  Purine metabolism
avo01100  Metabolic pathways
avo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AMS64_09035
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AMQ42504
UniProt: A0A2S3XQJ0
Position
1927004..1927489
AA seq 161 aa
MMQPQSCPAVEIQCEINGKPYSYAVPPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVD
GTAIDSCLYLAVWADGKSIRTVEGERKGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccgcagtggagatccagtgcgagatcaacggcaagcct
tactcctatgcagtgccgcccaccatgtcgttgctccatttcctgcgcgggcaggggctt
atcagtgtgaaagaggggtgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtggat
ggcactgccatcgacagctgcctctatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggagagcgcaaaggtaacgaactctccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggtttttgcaccccgggcctcgtgatggcgagcgcggctctg
ctcgacaagaccgaacgccgtccgctgaccgatgcggagatccgccgcgggctgtcgggc
aacctctgccgctgcaccgggtatcagaacgtggtgcgggcggtgaagaagtgctgcaag
ggttga

DBGET integrated database retrieval system