KEGG   Aeromonas veronii TH0426: AMS64_10065Help
Entry
AMS64_10065       CDS       T04529                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00071  Fatty acid degradation
avo00072  Synthesis and degradation of ketone bodies
avo00280  Valine, leucine and isoleucine degradation
avo00310  Lysine degradation
avo00362  Benzoate degradation
avo00380  Tryptophan metabolism
avo00620  Pyruvate metabolism
avo00630  Glyoxylate and dicarboxylate metabolism
avo00640  Propanoate metabolism
avo00650  Butanoate metabolism
avo00900  Terpenoid backbone biosynthesis
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
avo01120  Microbial metabolism in diverse environments
avo01130  Biosynthesis of antibiotics
avo01200  Carbon metabolism
avo01212  Fatty acid metabolism
avo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMS64_10065
   00630 Glyoxylate and dicarboxylate metabolism
    AMS64_10065
   00640 Propanoate metabolism
    AMS64_10065
   00650 Butanoate metabolism
    AMS64_10065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMS64_10065
   00072 Synthesis and degradation of ketone bodies
    AMS64_10065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMS64_10065
   00310 Lysine degradation
    AMS64_10065
   00380 Tryptophan metabolism
    AMS64_10065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMS64_10065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMS64_10065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMS64_10065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avo04147]
    AMS64_10065
Enzymes [BR:avo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMS64_10065
Exosome [BR:avo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMS64_10065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMQ42691
UniProt: A0A142E3F3
Position
complement(2161063..2162238)
Genome map
AA seq 391 aa AA seqDB search
MDIAIVAAKRTPMGAFQGALAEVTAPELGACAIEAALQQSGLRPEQVDEVFMGNVLAAGV
GQAPARQALLKAGLPDSVPATTVNKVCGSGMKAVMLAADTIRLGDNRVVVAGGMESMSRA
PYLLDNARNGFRMGHQKVLDHLFLDGLQDAYDGQLMGVHAQRSADQAGLTRSAMDEFALA
SLQRARDAQQASAFVSELTSVYRGERLLLAEDEQPGKGRPEKVPTLKPAFGKEGTITAAN
SSSISDGAAALILMDSATAQAWQVPVLARIVGYQSHAALPAEFTSAPIGAISRLLARLTW
SVEEVDLFEINEAFAMVTMLAMSGVGIPHHKVNVHGGACALGHPLGASGARILVTLIAAL
RQRGLGRGVAALCIGGGEATAIAVEVNDEAN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcaattgtggcggcaaaacggactccaatgggggcgtttcagggggcattg
gcagaggtaactgcgcctgagttgggagcctgtgccatcgaggcggcactgcagcaaagt
gggctgcgtccggagcaggtcgatgaagtgtttatgggcaatgtgctggcggcgggcgtg
gggcaagcgccagcccggcaggcgttgttgaaagcagggttaccagatagtgtgcctgct
accacggtaaacaaggtgtgcggatccggcatgaaagcagtgatgctggcggcggatacc
atccgccttggtgacaacagggtggtggtcgcgggggggatggagagtatgagccgtgcc
ccctatctgctggataatgcccgcaacggctttcggatggggcatcaaaaggtgttggac
cacctcttcctcgacggtttgcaagatgcctatgatggccagctgatgggggtacatgcc
cagcgcagcgccgatcaggccggtttgacccgcagtgccatggatgagtttgctcttgcg
tcgttgcagcgtgcccgtgatgcgcagcaagccagcgcgtttgtgtccgagcttacaagc
gtctatcgcggtgagcgcttgttgctggccgaagacgagcagcccggcaagggcagaccg
gagaaggtccctaccctgaagcctgcgtttggcaaggagggcaccattacggcagcaaat
tcgagctccatctcggacggtgcggcggcgctgatattgatggatagcgccacggcgcaa
gcctggcaggtaccagtgctggcacggattgtcggttatcagagccatgcagcattgccc
gccgagtttacctctgcacccattggcgccatttcacgcttgctggcgcgtctgacatgg
tcggtggaagaggtggatctgttcgagatcaacgaggccttcgccatggtcaccatgctg
gccatgagcggggtcggcatccctcatcacaaggtcaatgtgcatggtggggcctgtgca
ctcggtcatccgttgggggcgagtggcgcgcgcattctggtgacgctgatcgccgcgctg
cggcaacggggtctggggcgaggcgtagccgcgctctgtatcgggggcggggaggcgacc
gctatcgcggtcgaagtgaatgatgaggcgaattaa

DBGET integrated database retrieval system