KEGG   Aeromonas veronii TH0426: AMS64_15055Help
Entry
AMS64_15055       CDS       T04529                                 

Definition
(GenBank) aminotransferase class III
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00860  Porphyrin and chlorophyll metabolism
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
avo01120  Microbial metabolism in diverse environments
Module
avo_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
avo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMS64_15055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:avo01007]
    AMS64_15055
Enzymes [BR:avo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AMS64_15055
Amino acid related enzymes [BR:avo01007]
 Aminotransferase (transaminase)
  Class III
   AMS64_15055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMQ43572
UniProt: A0A2S3XTE1
Position
3279433..3280722
Genome map
AA seq 429 aa AA seqDB search
MTSRYQHSLALSARAEQSIPLGSQTFSKSRLCFPYGAAPLFIERGNGAHVWDVDGNEYLD
FASGLLAISLGYCDPDVNEAVMEQLSLGSIFSLPHRLETEVAEQLIELIPCAEMVRFGKN
GTDATSACIRLSRAVTGRERVAVCGYHGWQDWYIGSTTRHLGVPECVRELTHRFDYNDLA
SLQCLLEAHPGEFAAVILEPMNVTWPTPDFLPGLRQLCDAHGALLIFDETITGFRYHLGG
AQSLFGVTPDLAAFGKGMANGFPISAVVGRRQYMKRMEDIFFSGTFGGDVIALAAANAVI
KKMRRLDVPKRLAERGQQVLDGFDSLLKEIDAPDWLHTAGHPSWSFLLVADSVNHSTWLL
KSYLIQELCKRGILTLGSHNMNLAHSEQDVAALLAAYRDILPVLIRHDRDLTLASALDGE
PIQPVFKVR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgttatcaacattcactcgctctctcggcacgtgcggaacagagcattcca
ctcggctcccaaaccttctccaaaagtcgcctctgtttcccctatggcgccgccccactc
tttatcgagcgcggcaatggggcgcatgtttgggatgtagatggcaacgagtatcttgat
tttgccagcggcctactggccatcagtcttggatattgcgatccggatgtgaatgaagcg
gtaatggagcaactcagtcttggttcgatcttctcccttccccaccggctggaaactgaa
gtcgctgaacagctcattgagctcatcccctgcgccgaaatggttcgctttggcaaaaac
gggactgatgccacctcagcctgtatcaggctctccagagcagtcacaggccgcgagcgg
gtagccgtctgtggctatcatggctggcaagactggtacatcggctcaaccacccgccat
ttgggggtccccgagtgcgtgagagagctgacccacagatttgactacaacgatcttgcc
tcgctgcagtgcctgctggaagctcacccgggcgagtttgcagccgtcattctggaaccg
atgaatgtaacctggccaaccccggattttctgcctggtctgcgccaactctgcgatgcc
catggcgcactactcatctttgatgagaccattaccggttttcgctaccacttgggcggg
gcacagagcctctttggtgtgacgccggatcttgctgcgttcggcaaaggcatggccaat
ggtttcccgatttccgccgttgttggccgccgccaatatatgaaacggatggaagatatc
ttcttctccggcaccttcggcggggatgtaattgccctcgctgcggccaacgccgtcatc
aaaaagatgcggcgactggatgtaccaaagaggcttgcagagcggggacaacaggtactg
gatgggttcgatagcttgctaaaagagatcgatgccccggactggctgcataccgccgga
catccgagctggagctttctgctggttgcggattcagtaaaccactctacctggcttctc
aagagctatctgatccaggagttgtgcaagcgagggatcctcacccttggcagtcacaat
atgaatctggcccacagcgaacaggatgtggccgctttgctggccgcctatcgcgacata
ctgccagtgctcattcgtcacgatagagatctgacactggccagtgcgcttgatggagaa
cctattcaacctgtattcaaggtgagataa

DBGET integrated database retrieval system