KEGG   Aeromonas veronii TH0426: AMS64_15435Help
Entry
AMS64_15435       CDS       T04529                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00620  Pyruvate metabolism
avo00630  Glyoxylate and dicarboxylate metabolism
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
avo01120  Microbial metabolism in diverse environments
avo01200  Carbon metabolism
Module
avo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMS64_15435
   00630 Glyoxylate and dicarboxylate metabolism
    AMS64_15435
Enzymes [BR:avo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMS64_15435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase SLATT_3
Motif
Other DBs
NCBI-ProteinID: AMQ43642
UniProt: A0A2S3XRU7
Position
3376240..3377847
Genome map
AA seq 535 aa AA seqDB search
MSAPAQTHCSARLRIQGEMLPEYAQILTPDAVALVSELVERFAPQRGELLKQRVARQARI
DGGELPDFLPETAHIREGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADF
EDSLAPAWNKVIEGQINLRDAVNGTISYTSPEGKAYTLNPNPAVLICRVRGLHLPEKHVT
FDGEPIPGGLFDFALYFLHNYQALLAKGSGPYFYVPKLQSHLEGRWWSEVFAWTEDKFGL
PRGTIKATVLIETLPAVFEMDELLYQMKDHIVALNCGRWDYIFSYIKTLKNHPDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAAVNEQVFAKVKADKEREAN
NGHDGTWVAHPGLADTAMAVFNATIAAGAKNQIGVLREQDAPITAADLLAPCEGERTEAG
MRTNIRVALQYLEAWINGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKSLSNGKVVTKA
LFRQMLAEELEVVKAEVGTTRWQAGRFAEAGELMEEITCADTLIDFLTLPGYERL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaccggctcagacccactgcagcgcccgccttcgcatccagggcgagatgctg
cccgaatacgcgcaaattctgacgccggacgcggtggctctagtctccgaactggtggaa
cgttttgctccccaaagaggggaattgctgaaacaacgtgtggcacgccaggcccgtatc
gatggcggcgagctgccggacttcctgccggaaaccgcccacatccgtgaaggtgactgg
accattcgcggcattcccgccgacctgcaagaccgccgtgtggagatcacaggcccggtc
gagcgcaagatggtgatcaacgccctcaacgccaacgtcaaggtgttcatggcagatttt
gaggattcgctggcacccgcctggaataaggtgatcgagggccaaatcaacctgcgcgat
gcggtcaacggcaccatctcttacaccagtccggaaggaaaggcctataccctgaacccc
aatccggctgtgctcatctgccgagttcgtggtctgcacctgccggaaaaacatgtcacc
ttcgatggcgagcccatccccggcggtctgttcgattttgccctctacttcctgcacaac
tatcaggcgctgctggccaaaggctccggcccctacttctacgtccccaagctgcagagc
catctggaagggcgctggtggagcgaggtgttcgcctggaccgaggacaagttcggcctg
ccccgcggcaccatcaaggccaccgtgcttattgaaaccctgccggccgtgttcgagatg
gatgagctgctctatcagatgaaagatcacatcgttgcgctgaactgcggccgctgggac
tacatcttcagctatatcaaaaccttgaagaaccatccggatcgggtactgcctgatcgt
caggtggtgaccatggacaagccgttcctctccgcctactcgcggctgctgatcaagacc
tgccacaagcgcggtgcgctggcgatgggtggcatggccgcctttattccggccaaggac
gcggccgtcaacgagcaggtcttcgccaaggtcaaggccgacaaggagcgcgaagccaac
aacggccacgacggtacctgggtcgcccaccctggcctggccgataccgccatggcggtg
ttcaacgccaccattgcggctggtgccaagaaccagatcggcgtgctgcgtgagcaggat
gcccccatcaccgccgccgacctgctggcaccctgtgagggcgagcgcaccgaggcaggg
atgcgcaccaatatccgggttgccctgcaatatctggaggcctggatcaacggcaacggc
tgcgtgcccatctacggtctgatggaagatgccgccaccgccgagatctcccgtacctcc
atctggcagtggatccgccacggcaagagcctgtcgaatggcaaggtggtgaccaaggcg
ctgttccgccagatgctggccgaggagctggaggtggtcaaagccgaggtgggcaccacg
cgctggcaggcaggacgctttgccgaggcaggcgagctgatggaagagatcacctgcgcc
gacaccctgatcgattttctgacgctgcccggttacgagcggctctga

DBGET integrated database retrieval system