KEGG   Aeromonas veronii TH0426: AMS64_19340Help
Entry
AMS64_19340       CDS       T04529                                 

Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
avo  Aeromonas veronii TH0426
Brite
KEGG Orthology (KO) [BR:avo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AMS64_19340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMQ44354
Position
4229052..4229414
Genome map
AA seq 120 aa AA seqDB search
MALPHIEIRPYPVYVAGSKDPYQFHYLIEIENLGPGPVQLLHRRWLITDANGKMQEVAGP
GVVGEQPVIAEGETYRYQNGVPLATPLGVMEGSYTLQDGSGQQFEAPIAPFTLAIPNIIN
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtggcactcccgcacatcgagatccgcccataccccgtgtatgtggcgggctccaaagac
ccttaccagtttcactatctgatcgagattgagaatctggggcccggcccggtgcaactg
ctgcatcggcgctggctcatcaccgatgccaatggcaagatgcaggaagtggcaggcccg
ggcgtggtcggggaacaacccgtcattgccgaaggtgagacctaccgctaccagaacggc
gtgccgctggcgaccccgcttggggtgatggaagggagctataccctgcaagatggctct
ggtcagcagtttgaggcgcccatcgcccccttcacgctggccatccccaatattatcaac
tga

DBGET integrated database retrieval system