KEGG   Aeromonas veronii TH0426: AMS64_22270Help
Entry
AMS64_22270       CDS       T04529                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00860  Porphyrin and chlorophyll metabolism
avo01100  Metabolic pathways
avo01110  Biosynthesis of secondary metabolites
Module
avo_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:avo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMS64_22270
Enzymes [BR:avo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AMS64_22270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AMQ44879
UniProt: A0A2S3XIL6
Position
complement(4844144..4845517)
Genome map
AA seq 457 aa AA seqDB search
MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNESFGYPDFVRAAGQYLERNLSLYVHIP
FCHKLCYYCGCNKVITRHQHKADEYLDYLEQEIKAQAPLFKHRLVTQLHWGGGTPTYLDE
AQTRRLMAMLREHFHFAEEGEFSIEVDPREIAITMLDVLRDVGFNRISLGVQDFNKDVQV
AVNREQDNDFIKAMLERARELGFRSTNLDLIYGLPHQDRASFHHTLEEVLKTDPARLSIF
NYAHLPSRFAAQRKLKEVDMPAPQEKLAMLQDTIAFLTGQGYQFIGMDHFAKPDDELAVA
QREGKLHRNFQGYTTQGDCDLLGLGVSSISMIGDAYSQNQKELKAYYAQVAELGHAQWKG
CSLNQDDLIRREVIKRLICDFRLNFASVEQAHGLNFREYFADDLKLLQTFINDGLVRMTK
DGLEVSSTGQLLIRNICMCFDVYLRNKARQQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcagaacagattgtgtgggatcaggccctgatcgaaaaatataactacagtggc
ccgcgttacacctcttatcccactgcgctggagttcaacgagagcttcggctatccggat
tttgtccgcgcagccggccagtatctcgagcgcaatctgtcgctctacgtgcatatccct
ttctgtcacaagctctgctactactgcggctgcaacaaggtcattacccgccatcagcac
aaggctgacgagtacctcgactacctggagcaggagatcaaggcgcaagccccgctcttc
aagcatcgtctggttacccagctgcactgggggggcggtacacccacctatctggatgaa
gcgcaaacgcgccgtctgatggccatgctgcgtgagcacttccatttcgccgaagagggg
gagttcagcatcgaggtcgatccgcgcgagattgccattaccatgctggatgtgctgcga
gatgtcggcttcaaccgcatcagcctcggggtgcaggacttcaacaaggatgtgcaggtt
gcggtcaaccgcgagcaggacaacgactttattaaagccatgttggaacgggcccgtgaa
ctaggcttccgctcgaccaacctcgaccttatctatggcctgccgcatcaggatcgtgcc
agcttccaccatacgctggaagaggtgctcaagacggatccggcgcgcctctccatcttc
aactatgcccatctgccgagccgctttgctgcccagcgcaagttgaaagaggtggatatg
cctgcgccgcaggagaagctggccatgctgcaggataccatcgccttcctcaccggtcag
ggttaccagtttatcggcatggatcattttgccaagcccgatgacgagctggcagtggcg
cagcgcgagggcaagctgcaccgcaacttccagggctataccactcaaggtgattgcgat
ctgctggggctgggtgtctcctccatcagcatgatcggtgatgcctattcccagaaccag
aaagagctcaaggcgtattacgcacaggttgcagagctgggtcatgcccagtggaaaggt
tgctcgctcaatcaggatgacctgatccgccgtgaggtgatcaagcggcttatctgtgat
ttccgtctgaactttgcgtctgtcgagcaggcgcacggtctcaatttcagagagtatttt
gccgatgatctcaagctgctgcagaccttcatcaacgatggattggtgcgtatgacgaag
gatggtctggaggtctcctccaccgggcagctgctgatccgcaatatctgcatgtgcttc
gacgtgtacctgcgcaacaaggcgcgccagcaacagttctctcgcgtgatataa

DBGET integrated database retrieval system