KEGG   Aeromonas veronii B565: B565_0064Help
Entry
B565_0064         CDS       T01462                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
avr  Aeromonas veronii B565
Pathway
avr00540  Lipopolysaccharide biosynthesis
avr01100  Metabolic pathways
Module
avr_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    B565_0064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:avr01005]
    B565_0064
Enzymes [BR:avr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     B565_0064
Lipopolysaccharide biosynthesis proteins [BR:avr01005]
 Unusual sugar
  B565_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AEB48099
Position
78322..79278
Genome map
AA seq 318 aa AA seqDB search
MIVVTGGAGFIGSNLVKQLNAQGRTDIVVIDDLTDGTKFVNLVDLTIADYMDKDEFQARI
VSGDEFEEWDNGIEVIFHEGACSATTEWNGKFIMEVNYEYSKDLFHYCIEREIPFIYASS
AATYGGRNDNFIEDPKFEQPLNVYGYSKQLFDQYVRRWMPEINSQVVGLKYFNVYGPREQ
HKGSMASVAFHLNTQVKKGENPKLFEGCDGFPNGGQMRDFIYIDDVCKVNLWFWQNPQHS
GIFNCGTGRAEPFQNVAEAVIKHHQKGAIEYIPFPDHLKGRYQSFTQADMTKLRSVGYDA
EFKTVAEGVADYMAWLNR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtaactggcggtgctggctttatcggcagcaatctggtcaagcagctgaac
gctcaaggacggaccgatatcgtggtcattgatgacctgaccgacggcaccaagttcgtc
aacctggtcgatctgaccatcgctgactacatggacaaagacgagtttcaggcgcgcatc
gtctccggtgacgagtttgaagagtgggataacggcattgaggtgatcttccacgaaggc
gcctgctctgccaccaccgaatggaacggcaagttcatcatggaggtcaactacgagtac
tccaaggatctgttccactactgcatcgagcgtgaaatcccgttcatttacgcctcttct
gccgcgacctacggtggccgcaacgacaacttcatcgaagatcccaagttcgaacagccg
ctcaacgtctacggctactccaagcagctgtttgaccagtacgtgcgccgctggatgccg
gagatcaactctcaggttgtcggtctgaagtacttcaacgtctacggcccgcgcgagcag
cacaaaggctccatggcttccgtcgccttccacctcaatacccaggtgaagaagggcgag
aatcccaagctgttcgaaggttgcgatggcttcccgaacggtggtcagatgcgtgacttc
atctatatcgacgacgtctgcaaggtaaacctctggttctggcagaacccgcagcactcc
ggcatcttcaactgtggtaccggccgtgccgagccgttccagaacgtggccgaagcggtg
atcaagcatcatcagaagggagctatcgagtacatccctttcccggatcacctcaagggt
cgttaccagagcttcacccaggctgacatgaccaagctgcgcagcgtgggttatgacgcc
gagtttaaaaccgttgccgaaggggtagcggattacatggcctggctcaaccgctaa

DBGET integrated database retrieval system