KEGG   Aeromonas veronii B565: B565_0273Help
Entry
B565_0273         CDS       T01462                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00030  Pentose phosphate pathway
avr00051  Fructose and mannose metabolism
avr00680  Methane metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_0273
   00030 Pentose phosphate pathway
    B565_0273
   00051 Fructose and mannose metabolism
    B565_0273
  09102 Energy metabolism
   00680 Methane metabolism
    B565_0273
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     B565_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AEB48308
Position
304488..305498
Genome map
AA seq 336 aa AA seqDB search
MRRELAIEFSRVTEAAALAGYKWLGRGDKNIADGAAVAAMRHILNQIEIDGEIVIGEGEI
DEAPMLYIGEKVGTGHGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGSFLKAPDMYM
EKLIVGPKAKGAIDLDQALELNLKSVAKALGKPLSRLTVITLAKPRHDKAIKEMQGLGVR
VFAIPDGDVAASILTCLPDSEVDMLYGIGGAPEGVISAAVIRALDGDMQARLVPRHRVKG
DSPEVRALGEQEIARCEALGIDVNKVLKLEDMAKNDNVIFSATGITKGDLLDGITSDGVM
ATTETLLIRGKSRTIRRIKSIHYLERKDSVVRDIIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgaactggcaatcgagttttcccgagtgacggaagcggctgcactggctggc
tacaagtggctcggacgtggtgacaagaatatcgctgatggggcggccgtagcggccatg
cgccacattctcaaccagatcgagatcgatggtgagattgtgatcggcgaaggtgaaatt
gatgaagcgccgatgctctatatcggcgagaaggttggtaccggacacggcgacgcggtg
gatatcgcggtcgatcccatcgagggtacccgcatgaccgccatgggtcaggccaacgcg
ctggccgtgctggcggtgggcgacaagggttctttcctgaaagcgcccgacatgtacatg
gaaaagctgatcgtcgggcccaaggccaaaggcgccatcgacctggatcaggctctcgag
ctgaacctgaagtccgtggccaaggcgctgggcaagccgctctcccgtctgaccgtcatt
accctggccaagccgcgtcatgacaaggcaatcaaggagatgcagggtctgggcgtgcgg
gtgttcgccattcctgatggtgacgttgccgcctccatcctcacctgtctgccggacagc
gaagtcgacatgctgtatggcatcggcggcgcaccggaaggggtgatctccgcggcggtg
atccgcgcgctggatggtgacatgcaggcccgtttggtgccgcgtcaccgcgtcaagggc
gacagcccggaagtgcgtgcgctgggcgagcaggaaattgcccgctgcgaagcgctgggc
atcgatgtcaacaaggtgctcaagctggaagacatggcgaagaatgacaacgtcatcttc
tccgccaccggcatcaccaagggtgatctgctggatggcatcaccagcgatggcgtgatg
gcgaccaccgagactctgttgatccgtggcaagtcgcgcaccattcgccgtatcaagtcg
atccattaccttgaacgcaaagacagcgtggtacgcgatatcatcctgtga

KEGG   Aeromonas veronii B565: B565_2227Help
Entry
B565_2227         CDS       T01462                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase class 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00030  Pentose phosphate pathway
avr00051  Fructose and mannose metabolism
avr00680  Methane metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_2227
   00030 Pentose phosphate pathway
    B565_2227
   00051 Fructose and mannose metabolism
    B565_2227
  09102 Energy metabolism
   00680 Methane metabolism
    B565_2227
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avr04147]
    B565_2227
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     B565_2227
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B565_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: AEB50262
Position
complement(2505573..2506679)
Genome map
AA seq 368 aa AA seqDB search
MIGIFFADACKRFQCQRMRSKGTKMRNMITMGEFIVKKQADYPTATGELTSLLSSIRLAA
KVVNREINKAGLADIIGSMGAENVQGEVQQKLDVYANERFKAALEARGEVCGMASEEEED
FVAFDSPLSKNSKYVVLIDPLDGSSNIDVNVSVGTIFSIYRRLSPQGSPVTLEDFLQPGN
RQVAAGYVVYGSSTMLVYTTGFGVNGFTYDPSIGCFCLSHENIRIPEEGKIYSINEGNYI
KFPDGVKKYLKYCQERDEATHRPYTSRYIGSLVSDFHRNLLKGGIYIYPSGTNSPNGKLR
LLYECNPMAFLVEQAGGKASDGFGRIMDIQPTALHQRTPYFVGSTKMVERAEAFMREFSA
HEDPANQC
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggcattttttttgccgatgcctgcaaacgttttcaatgccaacggatgcgatct
aaaggaacaaaaatgcgaaacatgatcaccatgggtgagttcatcgtcaaaaagcaggcg
gattatcctaccgcgaccggcgagctgacctcgttgctcagctcgatccgccttgctgcc
aaggtggtgaaccgggagatcaacaaggcgggactggcggatatcatcggttccatgggc
gctgaaaacgtacagggcgaggtgcagcagaagctggatgtctacgccaacgaacgcttc
aaggcggcgctggaagcgcgcggcgaggtgtgtggcatggcctcggaagaggaagaggac
ttcgtcgcctttgactcaccgctctccaaaaactccaagtatgtggtgctgatcgacccg
ctcgatggctcctccaatatcgacgtcaacgtctcggtcgggaccatcttctccatctac
cgccgtttgagcccgcagggttcgccggtgacgctggaggacttcctgcaaccgggcaac
cgtcaggtcgccgccggttatgtggtctacggctcctccaccatgctggtctacaccacc
ggttttggcgtcaacggctttacctacgatccctctatcggctgcttctgcctctcccac
gagaacatccgcattccggaagagggcaagatctactccatcaacgagggtaactacatc
aagttcccggacggggtgaagaagtacctcaaatattgccaggagcgcgacgaggcgacc
cacagaccttacacctcccgttatatcggctccctggtttccgatttccatcgcaacctg
ctcaagggcggcatctacatctatccgtccggcaccaactccccgaacggcaagctgcgg
ctgctctatgagtgcaacccgatggcgtttctggtagagcaggctggtggcaaggcctcc
gacggttttggccgcatcatggatatccagcccaccgcgctgcaccagcgcaccccttac
tttgttggctcgaccaagatggtggagcgggccgaggcctttatgcgagagttctccgcc
catgaggatccagccaaccagtgctga

DBGET integrated database retrieval system