KEGG   Aeromonas veronii B565: B565_0405Help
Entry
B565_0405         CDS       T01462                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00020  Citrate cycle (TCA cycle)
avr00620  Pyruvate metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_0405
   00020 Citrate cycle (TCA cycle)
    B565_0405
   00620 Pyruvate metabolism
    B565_0405
Enzymes [BR:avr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     B565_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AEB48440
Position
complement(444224..445849)
Genome map
AA seq 541 aa AA seqDB search
MTIVAEPTLAQQLGLDQYGIKNSQEIVRNPSYEQLFAEETRPDLEGFERGVVTELGAVNV
NTGIFTGRSPKDKYIVKDATTQDTVWWSDQGKNDNKAITPEVWSHLKGLVTKQLSGKRLF
VVDGFCGANPDTRLAVRIITEVAWQAHFVKNMFIRPSDEELKTFKPDFVVMNGAKCTNPN
WKEQGLNSENFVAFNMTEKMQLIGGTWYGGEMKKGMFSMMNYFLPLRGIASMHCSANVGQ
DGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDHGVFNFEGGCYAKTIKLSEEAEPD
IYHAIRRDALLENVTVAADGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIF
LTADAFGVLPPVSKLTKEQTKYHFLSGFTAKLAGTERGITEPTPTFSSCFGAAFLSLHPT
KYGQELVKRMEAAGAEAYLVNTGWNGTGKRISIKDTRAIIDAILDGSIEKAETKVLPIFN
LEIPTALHDVNPAILDPRDTYADKAEWDAKAVDLAGRFIKNFERFTDNDEGKRLVAAGPQ
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgtggcagaacccaccctggcccaacaattaggactggaccagtacggcatc
aaaaacagccaagaaatcgttcgcaacccctcttacgagcagcttttcgccgaagagaca
cgccctgacctggaagggttcgagcgcggtgtggtgaccgagctgggcgccgtcaacgta
aacaccggtatcttcaccggtcgctccccgaaagataaatatatcgtcaaagatgccact
acccaggatactgtgtggtggtctgaccagggtaaaaacgataacaaagctattaccccg
gaggtgtggtcacatctgaaagggctggtcaccaaacagctctccggcaagcgcctgttt
gtagtcgacggtttctgcggtgccaacccggatacccgcctggccgtgcgcatcatcacc
gaggtggcctggcaggcacacttcgtgaaaaacatgttcatccgtccgagcgatgaagag
ctgaaaaccttcaagcctgacttcgtggtgatgaacggtgccaagtgcaccaacccgaac
tggaaagaacagggtctcaactccgagaactttgttgccttcaacatgaccgagaagatg
cagctcatcggtggcacctggtacggtggcgagatgaagaagggcatgttctccatgatg
aactacttcctgcccctgcgcggcattgcctccatgcactgctccgccaacgtgggtcag
gacggcgacgtcgccatcttcttcggcctctccggcaccggcaagaccaccctctccacc
gatcccaagcgtcagctgatcggcgatgacgagcacggctgggatgaccacggcgtgttc
aacttcgaagggggctgctacgccaagaccatcaagctctccgaagaggccgagccggac
atctaccacgccatccgtcgcgatgcgctgctggagaacgtgaccgttgctgccgatggc
accatcgacttcgatgatggctccaagaccgagaacacccgcgtctcctaccccatctat
cacatcgacaacatcgtcaagccggtctccaaggcaggtcacgccaccaaggtgatcttc
ctgactgccgacgccttcggcgtgctgcccccggtctccaaactgaccaaggagcagacc
aagtaccacttcctgtctggcttcaccgccaaactggccggtaccgagcgcggcatcacc
gagccgaccccgaccttctcctcctgcttcggcgcagccttcctctccctgcacccgacc
aagtacggtcaggagctggtgaaacggatggaagcggcaggggcagaggcctatctggtc
aacaccggctggaacggcaccggcaagcgcatctccatcaaggatacccgcgccatcatc
gatgccatcctggatggctccatcgagaaggcagagaccaaggtgctgccgatcttcaat
ctggagatcccgaccgcactgcacgatgtgaacccggcgatcctcgacccgcgcgacact
tacgccgacaaggccgagtgggatgccaaggccgtcgatctggcagggcgcttcatcaag
aacttcgagcgcttcaccgataacgacgaaggcaaacgtctggttgcggcaggcccgcag
ctgtaa

DBGET integrated database retrieval system