KEGG   Aeromonas veronii B565: B565_0730Help
Entry
B565_0730         CDS       T01462                                 

Definition
(GenBank) Amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
avr  Aeromonas veronii B565
Pathway
avr00330  Arginine and proline metabolism
avr00360  Phenylalanine metabolism
avr00380  Tryptophan metabolism
avr00627  Aminobenzoate degradation
avr00643  Styrene degradation
avr01100  Metabolic pathways
avr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    B565_0730
   00360 Phenylalanine metabolism
    B565_0730
   00380 Tryptophan metabolism
    B565_0730
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B565_0730
   00643 Styrene degradation
    B565_0730
Enzymes [BR:avr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     B565_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase TetR_C_31
Motif
Other DBs
NCBI-ProteinID: AEB48765
Position
794783..796495
Genome map
AA seq 570 aa AA seqDB search
MIEVTEVSIAELRAALESGRTTAVELVKAYLARIEAYNGPETATKLNALVVANPDALKEA
EASDARRARGETLGPLDGIPYTAKDSYLVKGLTAASGSPAFKDLVAQRDAFTVERLRAAG
AICLGKTNMPPMANGGMQRGVYGRAESPYNADYLTAPFASGSSNGAGTATAASFSAFGLA
EETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYARTMNDLLEVLDVVVA
DDADTRGDLWRMQPWVQLPKASEVRPASYLELAAKPDALKGKRLGVPRMFINKDELAGTS
ENPGIGGPTGQRIHTRETVISLWEQARQALEAAGAEVIEVDFPLVSNCEGDRPGAPTVFN
RGIVSPEFLNDELWELSGWAFDDFLRANGDPKLNKLADVDGPKIFPHDPGTLPNREGDLA
AGMDEYVNMAKRGLKSWDEIVTVPDGLRGLEKTRKLDLEDWMDGLKLDAVLFPTVADVAP
ADADVNPASADIAWSNGIWVANGNLAIRHLGVPTVTVPMGVMADIGMPVGLTFAGRAYDD
NNLLRFASAFESTGSKRMVPPRTPPLGDIS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagtgaccgaggtttccattgccgagctgcgtgccgcgctcgaatcaggccgc
actactgcggtcgaactggtcaaggcctatctggcccggatcgaggcctacaacggcccc
gagactgccaccaaactcaacgccttggtggtcgccaatcccgatgcgctgaaagaggcc
gaggcttccgatgcccgccgtgcccgtggcgagaccctggggccactcgacggcatcccc
tacaccgccaaagacagctatctggtcaaggggctgactgccgcctccggcagcccggcc
ttcaaggatctggtggcccagcgcgatgcctttaccgtggagcggctgcgcgccgccggt
gccatctgccttggcaaaaccaatatgccgccgatggccaatggtggcatgcagcgcggc
gtctatggtcgtgccgaaagcccctacaacgccgactacctgaccgcgccgtttgcctcc
ggctcttccaacggcgccggtaccgccaccgccgccagcttctccgccttcggtctggcg
gaagagacctggtcgagcggccgtggccctgcctccaacaacggcctgtgtgcctacacc
ccgtcccgtggcgtcatctcggtgcgcggcaactggccgctgaccccgaccatggatgtg
gtggtgccctatgcccgcaccatgaacgacctgctggaagtgctcgacgtagtagtggcc
gacgatgccgatacccgtggcgatctgtggcgcatgcagccctgggtgcagctgcccaag
gcttctgaagtgcgtccggcttcctatctggagctggctgccaagcccgatgccctcaag
ggcaagcgcctcggcgtgccgcgcatgtttatcaacaaggatgaactggctggcaccagc
gaaaaccccggtatcggcggcccgaccggtcagcgcatccatacccgcgagaccgtgatc
tcgctgtgggagcaggctcgtcaggcgctggaagccgctggcgccgaagtcatcgaagtg
gacttcccgctggtctccaactgcgaaggggaccgacccggcgcgccgaccgtgttcaat
cgcggcatcgtgagcccggagtttctcaacgacgagctgtgggagctctccggctgggcg
tttgacgacttcctgcgcgccaacggcgatcccaagttgaacaagctggccgatgtcgat
gggccgaagatcttcccccacgatccgggcacattgccgaaccgcgagggcgatctggcg
gcgggcatggacgagtacgtcaatatggccaagcgtggcctgaaatcctgggacgagatc
gtcacagtgccggatggcctgcgcggtctggagaagacccgcaagctggacctggaggac
tggatggacgggctcaagctcgacgccgtgctgttcccgaccgttgccgacgtcgccccg
gctgatgcggatgtgaatccggcctccgccgatatcgcctggagcaacggcatctgggtt
gccaacggcaacctcgccattcgccatctcggcgtgccgaccgtcaccgtccccatgggg
gtgatggccgatatcggtatgccggtgggcctgaccttcgccggtcgcgcctatgacgac
aacaacctgctgcgctttgcttcggcctttgaatccaccggcagcaagcgtatggtgccg
ccacggacgccgccgttgggggatattagttag

DBGET integrated database retrieval system