KEGG   Aeromonas veronii B565: B565_1672Help
Entry
B565_1672         CDS       T01462                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
avr  Aeromonas veronii B565
Pathway
avr00020  Citrate cycle (TCA cycle)
avr00190  Oxidative phosphorylation
avr00650  Butanoate metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B565_1672
   00650 Butanoate metabolism
    B565_1672
  Energy metabolism
   00190 Oxidative phosphorylation
    B565_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEB49707
Position
1869337..1869681
Genome map
AA seq 114 aa AA seqDB search
MVTNSATFGRSGVHDYILIRATALIMTCYVLYLVGFVAFNDITYEVWAGFFAKTFTKVFT
LLTLLCVLIHAWIGLWQVLTDYIKPVGLRGALQFALVVVLFVYLMTGFVVLWGV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattctgcaaccttcgggcgcagcggcgttcacgattacatcctgatccgc
gccaccgccctcatcatgacctgttatgtcctctatctggtgggctttgtcgcgttcaac
gacatcacctacgaggtgtgggcaggcttcttcgccaaaacattcaccaaggtattcacc
ctgttgaccctgctctgcgtactgatccacgcctggattggtctgtggcaggtgctgact
gactatatcaagccggtagggctacgcggggcgctgcaatttgccctggtcgtggtgctg
tttgtctatctgatgacgggtttcgtcgtgctgtggggtgtgtaa

DBGET integrated database retrieval system