KEGG   Aeromonas veronii B565: B565_1863
Entry
B565_1863         CDS       T01462                                 

Definition
(GenBank) Xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
avr  Aeromonas veronii B565
Pathway
avr00230  Purine metabolism
avr01100  Metabolic pathways
avr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B565_1863
Enzymes [BR:avr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     B565_1863
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AEB49898
Position
2084954..2087272
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSNIAHGKVLAIDATEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDEAKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAQSALADGAYPIHPSGNLLRQSQLRANDPEQAIASADLQFQAH
YRTPVVQHCHLETVTCYAYMDQPDHIIVVSSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGKMGLNRDGT
LKGYQLDVLSNTGGYASHGHSIASAGGNKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVIFALECMLDDACAELGLDPLDVRIANVAREGDVNQVNQKTIYSAGLPDCLIRGREM
FEWDRLKTECLEQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRIINLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKSGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGSGEEQHHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctataccgatgacaacatcatgctcgggatgcgccacgccaagtacgtgcgaagcaat
attgcccacggcaaggtgcttgccatcgatgcgaccgaggcactggccctgcacggggtc
gaagccgtgtttacccatgaagatgtccctaccacctgttttcgcaccgccggtcacgcc
tggtccctcgatgaggcgaaacgggatgtgaaagaccgccgtctgctcaccgaccatgta
cgccactttggtgatggggtcgccatcgtggtggcgcgcgatccgctggtggccgaaaaa
gcggccgcgctggtcaaggtgacttacgagccgctgccggtgatgacggatgcccaaagc
gcgctggccgacggtgcctatcccatccacccgagcggcaatctgctgcgccaaagccag
cttcgcgccaatgacccggagcaggccattgcctccgctgacctgcaatttcaggcgcac
taccggacgccggtggtgcagcactgccatctggagacggtgacctgctacgcctacatg
gatcaaccggaccacatcatcgtcgtcagcagcacccagatcccccagatagtgcgtagc
cgggtggccaagtccctcggcctgccctggtctagcgtgcgagtgatcaaaccctatatg
ggcggcggctttggcaacaagcaggatgtgctggaagagccgatggcggcgtttttgagc
tacaaactcggcggtgtgccggtcaaggtgaccttgagccgggaggagtgcttctttgcc
tctcgtacccgccacggttttgccatcgatggcaagatgggcctcaaccgcgacggcacc
ctcaagggctatcagctcgacgtgctctccaacactggcggctatgcctctcacggccac
tccatagccagcgccgggggcaacaagatcagctacctctatccgcgcagcgccttcggt
tatgacgccaagaccttctacagcaacctgcccaccgctggtgccatgcgcggttacggc
gcgccccaggtgatttttgccctcgaatgcatgctggatgacgcctgcgccgaactgggg
ctggatccgcttgatgtgcggatcgccaacgtggcgcgggaaggggacgtcaatcaggtc
aaccagaagaccatctacagcgccgggttgcccgactgcctgatccgtggtcgcgagatg
ttcgagtgggatcgactcaagactgagtgtctggagcaggatccggcgagccgggtgcgg
cgcggcattggggtggcctgtttcagctacggctccaacacctatccggtgggggtcgaa
attgctggtgcccgcatgctgctcaatcaggatggcaccgtcaatctgcagatcggtgcc
accgagatagggcaggggtcggacaccgtctttgcccagatggcggcccagacgttaggc
attccgtttgagcagatccgggtcatctcgacccaggataccgacatcaccgcctatgat
ccgggctcgttcgcctcgcgccagagctatgtggcggcccctgccatccatcaggcggcg
ctgcagttgcgggctcgcattctgtcgctggcggcccaactctgccatcaggatgtagga
tcgctgaccctgatcgacggctacgtggtgctggccggtgcgccggacaaggtgctgatc
agcgtcgccgaggtgtcggtcaacgcctactaccacctcactatcggcggccagatcacc
tccgaggtctcccacaagaccaccaccaatccgccgagctttggctgcacctttgtcgat
ctcagcgtcgatatcgatctctgcaaggtgaccatcaatcgcatcatcaacctgcacgat
gcgggcaagatcctcaacccgcagctggcggagggacaggtgcatggcggcatggggatg
gggatcggctggtcgctgttcgaggagatgatcatcgacgccaagagcggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatttgccggagcttgaatgc
gacttcgtgcagacctacgagccccaatcggtctatggccacaaatccctgggggaaccg
ccgatcatttcgccgggcccggccatccgtaacgccatccgcatggcgaccggcgtcgcc
atcaacgagctgcccatcacccccaaaaccctgttccgggagtttgtcgcggcgggtttg
attggcgagggatcaggggaggagcaacaccatgtttga

DBGET integrated database retrieval system