KEGG   Aeromonas veronii B565: B565_1865
Entry
B565_1865         CDS       T01462                                 

Definition
(GenBank) Carbon monoxide dehydrogenase small chain
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
avr  Aeromonas veronii B565
Pathway
avr00230  Purine metabolism
avr01100  Metabolic pathways
avr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B565_1865
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AEB49900
Position
2088140..2088625
AA seq 161 aa
MMQPQTCPAVEIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVN
GTAIDSCLYLAVWADGKSIRTVEGERKGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaacctgtcccgccgtggagatccagtgcgaaatcaacggcaaacct
tactcctatgcggtgtcgcccaccatgtcgctgctccacttcctgcgcgggcaggggctt
atcagcgtgaaagaggggtgcagtgtcggcgagtgtggcgcctgtaccgtgcgggtgaat
ggcaccgccatcgacagctgcctctatctggcggtctgggccgatggcaaatccattcgt
accgtggagggggagcgcaaaggcaatgagctctccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggtttttgcaccccgggcctcgtgatggcgagcgcggccctg
ctcgacaagaccgagcgccgtccgctgaccgatgcggagatccgccgtgggctgtcgggt
aacctctgccgctgtaccggttatcagaacgtggtacgggcggtgaagaagtgctgcaaa
gggtga

DBGET integrated database retrieval system