KEGG   Aeromonas veronii B565: B565_1891Help
Entry
B565_1891         CDS       T01462                                 

Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
avr  Aeromonas veronii B565
Pathway
avr00450  Selenocompound metabolism
avr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B565_1891
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:avr03016]
    B565_1891
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     B565_1891
Transfer RNA biogenesis [BR:avr03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    B565_1891
 Prokaryotic Type
    B565_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AEB49926
Position
complement(2113637..2114674)
Genome map
AA seq 345 aa AA seqDB search
MSSIRLTQYSHGAGCGCKISPKVLDTILKSQIPGFNDPTLIVGNSSKDDAAVVDIGNGQG
IVSTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGKPIVAIAILGWPINTLPAEVAQQVI
DGGRQVCHEAGISLAGGHSIDAPEPIFGLAVTGIVPLDAIKQNDTAKVGDTLYLTKPLGI
GILTTAQKKGKLKPEHEQLAPNAMCTLNKIGQRFAELPGVHAMTDVTGFGLAGHLLEMCE
GSGVSASLDFKALPLLDEVDYYLSEGCVPGGTLRNHDSYGHKLDAMDDRTRNIMCDPQTS
GGLLVAVGKESEAELLAIAQEVGLELSPIGQIKPLDGSRFIEIVQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccattcgtctgacccaatacagccacggcgctggctgcggctgcaaaatctct
cccaaggtactcgacaccatcctcaagagccagatcccgggcttcaacgacccgaccctg
atcgttggcaacagcagcaaagatgacgcggccgtggtcgatatcggcaacggtcagggc
attgtctccaccaccgacttcttcatgcccatcgtcgatgaccccttcacctttggccgc
atcgccgccaccaacgccatcagcgatatctacgccatggggggcaagcccatcgtcgcc
atcgccatcctcggctggcccatcaataccctgcccgccgaagtggcccagcaggtgatc
gacggcggccgtcaggtgtgccatgaggcgggcatttcgctggccggtggccacagtatc
gatgcccccgagcccatcttcggccttgcggtgaccggtatcgtgcctctggatgccatc
aagcaaaacgacaccgccaaggtgggtgacaccctctatctgaccaagccccttggtatc
ggtatcctcaccacggcccagaagaagggcaagctcaaacccgaacacgagcagctggcc
cccaacgccatgtgcaccctcaacaagattggccagcgctttgccgagctaccgggtgtc
cacgccatgaccgacgtcaccggttttggtctggcgggccatctgctggagatgtgtgaa
ggctctggcgtcagcgccagccttgacttcaaggcgctgccgctgcttgatgaggtggat
tactacctctccgagggctgcgtaccgggcggtaccctgcgcaaccacgactcctacggc
cacaagctggatgccatggacgatcgcacccgcaacatcatgtgcgacccacaaaccagc
ggcggcctgctggtcgccgtgggtaaagagagcgaagccgagctgctcgccatcgcgcaa
gaagttgggctagaactctcgcccatcggtcagatcaagccccttgatggctcccgcttt
atcgagattgtccaatga

DBGET integrated database retrieval system