KEGG   Aeromonas veronii B565: B565_2037Help
Entry
B565_2037         CDS       T01462                                 

Definition
(GenBank) Fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
avr  Aeromonas veronii B565
Pathway
avr00071  Fatty acid degradation
avr00280  Valine, leucine and isoleucine degradation
avr00281  Geraniol degradation
avr00310  Lysine degradation
avr00362  Benzoate degradation
avr00380  Tryptophan metabolism
avr00410  beta-Alanine metabolism
avr00640  Propanoate metabolism
avr00650  Butanoate metabolism
avr00903  Limonene and pinene degradation
avr00930  Caprolactam degradation
avr01040  Biosynthesis of unsaturated fatty acids
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
avr01212  Fatty acid metabolism
Module
avr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B565_2037
   00650 Butanoate metabolism
    B565_2037
  Lipid metabolism
   00071 Fatty acid degradation
    B565_2037
   01040 Biosynthesis of unsaturated fatty acids
    B565_2037
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B565_2037
   00310 Lysine degradation
    B565_2037
   00380 Tryptophan metabolism
    B565_2037
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B565_2037
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B565_2037
   00281 Geraniol degradation
    B565_2037
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B565_2037
   00930 Caprolactam degradation
    B565_2037
Enzymes [BR:avr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B565_2037
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B565_2037
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     B565_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEB50072
Position
complement(2283392..2285542)
Genome map
AA seq 716 aa AA seqDB search
MMSAKTFSLDVRKDGIGILTMDVPGESMNTLKAAFVEEIRTVLAEVKRNKDLIGLVITSG
KKDSFIAGADITMLAACTSAKDAETLSREGQEIFAEIEGLTIPVIAAIHGPCLGGGLELA
LACHGRVVTDHGKSVLGLPEVQLGLLPGSGGTQRLPRLIGVAKALDLMLTGKQVRAKQAK
KLGLVDDVVPPSILLDAAIKLAKKGKPRHQLKRDLQGKVLETNKLGRKVLFDQASKGVKA
KTRGNYPAPERILDVVRIGVEEGMKAGLVAESRHFGELVMTAESAALRSIFFATTEMKKE
VTYQGAEPRKVAHAAVLGGGLMGGGIAFVTATKAGVPVRIKDVASAGIGNAMRYSYDILA
KKLKRRHILRSELEKQMSLLTGTLDYSGFHRVDMVVEAVFEDLALKHQMVKDVEHECGEH
TVFASNTSSLPINQIAAEAAHPERVVGLHYFSPVDKMPLAEIIPHAGTSAETVATTLAFA
RAQGKTPIVVKDEAGFYVNRILAPYMNEAARLVLEGEPVEVLDSALLDFGFPVGPITLLD
EVGIDVGAKISPILEKELGGEQFQAPKAFDKLLQNDRKGRKNGKGFYLYGKAAPRNKLTG
KEGKKTVDESVYGVLGIKPSAKLARQEIAERCVLLMLNEAAMALDSGVVASARDGDIGAI
FGIGFPPFLGGPFRYMDTLGIDHLVGRLEYYQKRHGDRFAPCARLKAMAAEQQTFY
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgctaagactttttccctggatgttcgcaaagatggcatcggcatcctcacc
atggatgtgccgggcgagagcatgaataccctgaaggccgcctttgtggaggagatccgc
accgtgttggccgaagtgaaacgcaacaaggatttgatcggtctggtgatcacctccggc
aagaaggactccttcatcgccggcgctgacattaccatgctggccgcctgcaccagtgcc
aaggatgccgagaccctgtcgcgagaagggcaggagatctttgccgagatcgaggggctg
accattccggtgatcgccgccattcacggcccctgcctcggtggcgggctggagctggcg
ctggcctgccatggtcgggtggtgaccgatcacggaaaatctgtgctgggattgccggaa
gttcagctcggtctgctgccgggctctggcggtacccagcgtctgccgcgcctcatcggg
gtggccaaggcgctggatctgatgctgaccggcaagcaggtgcgggccaaacaagccaag
aaattggggctggtggacgatgtggtgccgccgtcaatcttgctggatgctgccatcaag
ctggccaagaagggcaaaccgcgccatcagttgaaacgggatctgcagggcaaggtgctg
gagaccaacaaactgggtcgcaaggtgctgttcgatcaggctagcaagggggttaaagcc
aagacccgtggcaactacccggcgccggagcggatcctggacgttgtgcgcattggcgtg
gaggagggaatgaaggccggtctggtcgccgagtcccgccactttggcgagctggtgatg
actgctgagtctgccgccctgcgttccatcttctttgccaccaccgagatgaagaaagag
gtcacctatcagggggccgagccgcgcaaggtggcccatgccgccgtgctgggcggtggt
ctgatggggggcggcattgcgttcgtcaccgctaccaaggcgggagtgccggtgcggatc
aaggatgtggcaagcgccgggatcggcaatgccatgcgctacagctatgacattctggcc
aagaagctcaagcgtcgccacatcttgcgcagcgaattggaaaagcagatgagcctgttg
accggtaccctcgactactccggtttccaccgggtggacatggtggttgaggcggtgttt
gaagatctcgcgctcaaacaccagatggtgaaggacgtggagcatgagtgcggtgagcac
acagtgtttgcctccaacacctcctccctgcccataaaccagattgcggcagaggcggcg
cacccggagcgagtcgtggggctgcactacttcagcccggtggacaagatgccgctggcg
gagatcatcccccacgctggcaccagtgccgagacggtcgccaccactctggcttttgcc
cgtgctcagggtaaaacgcctatcgtggtgaaagacgaagccggtttctacgtcaaccgc
atcctggcgccctacatgaatgaggcggcaagactggtgctggaaggggagccggtagag
gtgctggatagcgcgctgctggactttggtttcccggttggccccatcaccttgctggac
gaggtggggatcgatgtgggcgccaagatctcccccattctcgagaaagagctgggcggc
gagcagttccaggcgcccaaggcgttcgacaagctgctgcaaaatgatcgcaagggacgc
aagaacggcaagggcttctacctctatggcaaggcggcaccgcgcaacaagctgaccggc
aaagagggcaagaagacggtggacgagagcgtctatggcgtgctcggcatcaagccgtct
gccaagctggcccgtcaggagatcgccgagcgctgcgtgctgctgatgctcaacgaagcg
gccatggcgctggatagcggcgtggtggcgtcggcccgtgatggcgatatcggcgccatc
ttcggcatcggtttcccgcctttccttggcggcccgttccgttatatggacacgctcggg
atcgatcatctggttggccgtctggagtattatcagaagcgccatggcgatcggtttgcc
ccctgtgcccgcctcaaggcaatggccgcagagcagcagaccttctactga

DBGET integrated database retrieval system