KEGG   Aeromonas veronii B565: B565_2050Help
Entry
B565_2050         CDS       T01462                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avr  Aeromonas veronii B565
Pathway
avr00071  Fatty acid degradation
avr00072  Synthesis and degradation of ketone bodies
avr00280  Valine, leucine and isoleucine degradation
avr00310  Lysine degradation
avr00362  Benzoate degradation
avr00380  Tryptophan metabolism
avr00620  Pyruvate metabolism
avr00630  Glyoxylate and dicarboxylate metabolism
avr00640  Propanoate metabolism
avr00650  Butanoate metabolism
avr00900  Terpenoid backbone biosynthesis
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
avr01212  Fatty acid metabolism
avr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B565_2050
   00630 Glyoxylate and dicarboxylate metabolism
    B565_2050
   00640 Propanoate metabolism
    B565_2050
   00650 Butanoate metabolism
    B565_2050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B565_2050
   00072 Synthesis and degradation of ketone bodies
    B565_2050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B565_2050
   00310 Lysine degradation
    B565_2050
   00380 Tryptophan metabolism
    B565_2050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B565_2050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B565_2050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B565_2050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avr04147]
    B565_2050
Enzymes [BR:avr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B565_2050
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B565_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEB50085
Position
complement(2299287..2300462)
Genome map
AA seq 391 aa AA seqDB search
MDIAIVAAKRTPMGAFQGALAEVTAPELGACAIEAALQQSGLRPEQVDEVFMGNVLAAGV
GQAPARQALLKAELPDSVPATTVNKVCGSGMKAVMLAADTIRLGDNRVVVAGGMESMSRA
PYLLDNARNGFRMGHQKVLDHLFLDGLQDAYDGQLMGVHAQRSADQAGLTRSAMDEFALA
SLQRARDAQQAGAFASELASVYRGDRLLLAEDEQPGKGRPEKIPTLKPAFGKEGTITAAN
SSSISDGAAALILMDGATAQAWQVPVLARIVGYQSHAALPAEFTSAPIGAISRLLARLAW
SVEEVDLFEINEAFAMVTMLAMSGVGIPHHKVNVHGGACALGHPLGASGARILVTLIAAL
RQRGLRRGVAALCIGGGEATAIAVEVNDEPN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcaattgtggcggcaaaacggactccgatgggggcgtttcagggggcattg
gcagaggtcactgcgcctgagttgggagcctgtgccatcgaggcggcactgcagcaaagt
gggctgcgtccggagcaggtcgatgaagtgtttatgggcaatgtgctggcggcgggcgtg
gggcaagcgccagcccggcaggcgttgttgaaagcagagttgccagatagtgtgcctgct
accacggtcaacaaggtgtgcggctccggcatgaaagcagtgatgctggcggcggatacc
atccgccttggtgacaacagggtggtggtcgcgggggggatggagagtatgagccgtgcc
ccctatctgctggataatgcccgcaacggctttcggatggggcatcaaaaggtgttggac
cacctattcctcgacggtttgcaagatgcctatgatggccagctgatgggggtgcatgcc
cagcgcagcgccgatcaggccggtttgacccgcagtgccatggatgagtttgctcttgcg
tcgttgcagcgtgcgcgcgatgcgcagcaagccggcgcatttgcatccgagctggcaagt
gtctatcgcggtgatcgcttgttgctggccgaagacgagcagcctggcaagggcagaccg
gagaagatcccgaccctgaagccagcgtttggtaaggaaggcactattacggcggccaat
tcgagctccatctcggatggtgcggcggcgctgatattgatggatggcgccacggcgcaa
gcctggcaggtacctgtgctggctcggatcgtcggttatcagagccacgcggcattgccc
gccgagtttacctctgcgcccattggcgccatttcacgcttgctggcgcgtcttgcatgg
tcggtggaagaggtcgatctgttcgagatcaacgaggccttcgccatggtcaccatgctg
gccatgagcggggtcggcatccctcatcacaaagttaatgtgcatggtggggcctgtgcg
cttggtcatccgctgggggcgagtggcgcgcgcattctggtgacgctgatcgccgcgctg
cggcaacggggtttgcggcgaggcgtggccgcgctctgtatcgggggcggggaggcgacc
gctatcgcggtcgaggtgaatgacgagccgaattaa

DBGET integrated database retrieval system