KEGG   Aeromonas veronii B565: B565_2581Help
Entry
B565_2581         CDS       T01462                                 

Definition
(GenBank) Isocitrate lyase, putative
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
avr  Aeromonas veronii B565
Pathway
avr00630  Glyoxylate and dicarboxylate metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01200  Carbon metabolism
Module
avr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B565_2581
Enzymes [BR:avr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     B565_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AEB50616
Position
2898326..2899657
Genome map
AA seq 443 aa AA seqDB search
MKEGTDMALTREQQIQAIEKDWAENPRWKGIKRGYSAEDVVNLRGSLQPVHTLAQRGADK
LWGLIHGDAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNLSSTMYPDQSLY
PANSVPSVVERINNSFARADQIQWANKVGPQDEGFIDYFLPIVADAEAGFGGVLNAFELM
KGMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVCGTTTLVIAR
TDANAADLLTTDADSYDADFLTGERTAEGFYKVRAGIDQAIARGLAYAPYADMVWCETAK
PDLDEARKFAEAIKAKFPDRILAYNCSPSFNWKKNLDDATIARFQQELSDMGYKYQFITL
AGIHNMWFHMYELAYQYARGEGMKHYVEMVQEPEFAAASRGYTFVAHQQEVGTGYFDKVT
TVIQGGQSSVTALTGSTEEDQFH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagggaactgatatggcactgacccgtgagcaacagatccaggctatcgagaaa
gactgggcggaaaacccccgctggaaagggatcaagcgcggctacagcgccgaagatgtg
gtaaacctgcgcggtagcttgcagccggtgcacaccctggctcagcgcggtgccgacaag
ctgtggggcctgatccacggcgacgccaagaaaggctacgtcaactgcctcggcgccctg
accggtggtcaggcggtgcagcaggccaaagcggggatcgaggcgatctacctctccggc
tggcaggtggcggcggacaacaacttgtcctccaccatgtatccggatcagtccctctac
ccggccaactcggtaccgtccgtggtggagcgcatcaacaactccttcgcccgcgccgac
cagatccagtgggccaacaaagtcgggccgcaggatgagggttttatcgactacttcctg
ccgattgtggccgatgcggaagccggtttcggtggcgtattgaacgccttcgaactgatg
aaggggatgattgaagcgggcgccgctggcgtgcacttcgaagatcagctggcatcagtg
aaaaaatgcggtcatatgggcggcaaggtgctggtaccgactcaggaagcggtgcagaag
ctggttgctgcccgtctggcagccgatgtgtgcggcaccaccaccctggtgatcgcccgt
accgacgccaacgccgctgacctgttgaccactgacgctgactcgtacgatgcagacttc
ctgactggcgaacgcactgctgaagggttctacaaggtgcgtgccggtatcgatcaggcc
atcgctcgcggtctggcttacgccccctacgccgacatggtgtggtgtgaaaccgccaag
ccggatctggacgaagcgcgtaaatttgccgaagcaatcaaggctaagttcccggatcgc
atcctggcctacaactgctccccgagcttcaactggaagaagaatctggacgatgccacc
atcgcccgcttccagcaggagctctccgacatgggctacaagtaccagttcatcaccctc
gcgggtatccacaacatgtggttccacatgtacgagctggcctaccagtacgcccgtggc
gaagggatgaagcactacgtcgagatggtgcaggagccggaatttgccgccgccagccgt
ggctacaccttcgtggcacaccagcaggaagttggtaccggttacttcgacaaggtgacc
accgtgattcagggtggccaatcatcggtcaccgcgctgaccggctccaccgaagaagat
cagttccactga

DBGET integrated database retrieval system