KEGG   Aeromonas veronii B565: B565_2659Help
Entry
B565_2659         CDS       T01462                                 

Definition
(GenBank) Phosphoglucomutase, alpha-D-glucose phosphate-specific
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00030  Pentose phosphate pathway
avr00052  Galactose metabolism
avr00230  Purine metabolism
avr00500  Starch and sucrose metabolism
avr00520  Amino sugar and nucleotide sugar metabolism
avr00521  Streptomycin biosynthesis
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
Module
avr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
avr_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_2659
   00030 Pentose phosphate pathway
    B565_2659
   00052 Galactose metabolism
    B565_2659
   00500 Starch and sucrose metabolism
    B565_2659
   00520 Amino sugar and nucleotide sugar metabolism
    B565_2659
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B565_2659
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B565_2659
Enzymes [BR:avr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     B565_2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEB50694
Position
complement(2988722..2990371)
Genome map
AA seq 549 aa AA seqDB search
MAQHSHAGQPARLSDLTNIPRLVSAYYLNKPDMSRPEQRVAFGTSGHRGSALHSAFTESH
ILAVTQALVEYRQQAGITGPLFVGMDTHALSESAFASAVEVLAANGVETRIQAGMGFTPT
PVISHAILRHNAGKPAARADGVVITPSHNPPEDGGFKYNPPHGGPAEGEITKWVEDRANA
ILEAGLAGVKRMPFAEALKSPFVVEHDYVTPYVDDLKNVLDMDAIKNAGIKIGVDPLGGS
GVAYWDVIAKTYGLNIEVVNYKVDPTFSFMTLDKDGKIRMDCSSPFAMASLIALKDKFDI
ALGNDPDYDRHGIVTKSGLMNPNHYLAVAIQYLFTHRTGWSADAAVGKTLVSSSMIDRVA
GEIGRTLKEVPVGFKWFVDGLYSGEFGFGGEESAGASFLRKDGTVWTTDKDGFILALLAA
EILAVTGKDPQAHYDVLEAKFGRSSYRRIDAPANSAQKAVLSKLDPALVEASTLAGEPII
AKLTKAPGNDAAIGGLKVVTENGWFAARPSGTESIYKIYMESFKGDAHLDLIQQEAQQIV
SAALAKAGV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcattcccacgccggtcaaccggcccgtttaagcgatctgaccaacatcccc
cgtctggtcagcgcctactacctcaacaagccggacatgagccgccccgagcagcgggtt
gccttcggtacctccggccaccgtggcagcgccctgcacagcgcctttaccgaatcccat
attctggcggtgacccaggcgctggtggagtatcgccagcaggccggcatcactggcccg
ctgtttgtcggcatggatacccacgccctgtccgaatccgcttttgccagcgccgtcgaa
gtgctggccgccaacggcgttgaaactcgcattcaagccggtatgggctttaccccgacc
ccggtcatctctcacgccatcctgcgccacaatgcaggcaaaccggctgcccgtgctgac
ggtgtggtgatcactccgtcccacaaccctccggaagatggtggcttcaagtacaacccg
ccccatggtggccccgccgaaggggagatcaccaagtgggtggaagaccgcgccaacgcc
attctggaagcgggtctggctggcgtgaaacggatgccgtttgccgaagccctcaagagc
ccgttcgtggtggagcacgactatgtcaccccttatgtggatgatctgaagaacgtgctg
gacatggacgccatcaagaatgcgggcatcaagatcggtgtcgatccgctgggcggctcc
ggcgttgcctactgggacgtcatcgccaagacctatggcctgaatatcgaggtggtgaac
tacaaggtcgacccgaccttctccttcatgaccctggataaagacggcaagatccggatg
gactgctccagcccgttcgctatggccagtctgattgccctcaaggacaagttcgacatc
gcccttggcaacgaccctgactacgaccgtcacggcatcgttaccaagtccggcctgatg
aacccgaaccattacctggcggtggcaatccagtatctgtttacccatcgcaccggctgg
tctgcggatgcggccgttggcaagacgctggtctcttcctccatgatcgaccgggttgcc
ggcgagattggccgcaccctgaaagaggtgccggtcggcttcaagtggttcgtggatggc
ctctacagcggcgagtttggctttggcggcgaagagagcgcgggcgcctccttcctgcgc
aaagatggtaccgtctggaccaccgacaaggatggtttcattctggcgctgctggcagcg
gaaattctggcggtgaccggcaaggatccgcaggctcattacgacgtactggaagccaaa
tttggccgctccagctatcgccgtatcgacgccccggccaacagcgcccagaaagcggtg
ctctccaagctggatccggcactggtagaagcctcaacgcttgccggtgagcccatcatc
gccaagctgaccaaggcgccgggcaacgatgccgccatcggcggcctcaaggtggtgacc
gagaacggctggttcgcggcgcgcccctccggcaccgagtccatctacaagatctatatg
gagagcttcaagggcgacgcgcacctcgacctcatccagcaggaagcccagcagatcgtc
tccgcggcactggccaaggccggcgtataa

DBGET integrated database retrieval system