KEGG   Aeromonas veronii B565: B565_2827Help
Entry
B565_2827         CDS       T01462                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
avr  Aeromonas veronii B565
Pathway
avr00260  Glycine, serine and threonine metabolism
avr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01130  Biosynthesis of antibiotics
avr01230  Biosynthesis of amino acids
Module
avr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B565_2827
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B565_2827
Enzymes [BR:avr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B565_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth PDDEXK_10
Motif
Other DBs
NCBI-ProteinID: AEB50862
Position
3183818..3184624
Genome map
AA seq 268 aa AA seqDB search
MNRYAQLFSRLDEANQGAFVPFVMLGDPTPELSLAIVDALVAGGADALELGIPFSDPVAD
GPTIQGAALRAFASHTTPDDCFELLGRIRAKYPQLPIGLLVYANLVYVRKIDGFYEKCQQ
AGVDSVLVADVPVQMCAPYKAAADKFGIDSIFIAPPNGDAETLKQVAELGNGYTYLVSRA
GVTGAETKAGMPVEGLINTLREFNAPPALLGFGISEPAQVREAIAAGAAGAISGSAVVKI
IETHHQNPEHMLTRLKEFVEGMKAATNR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttacgcacaactcttctcccgtctggacgaggccaatcagggcgcctttgtg
ccgttcgtgatgctgggggaccccactcctgaactctcgctagccatcgtcgatgcgctg
gtcgcagggggcgccgatgccctcgagctcggcattcccttctccgatccggtagcggac
ggccccaccattcagggcgccgctctgcgcgcttttgccagccacaccaccccggacgac
tgcttcgagctgcttggccgcatccgcgccaagtacccgcagctgccgattggcctgctg
gtctacgccaacctggtctatgtgcgcaaaatcgacggtttctacgagaagtgccagcag
gcgggcgtggactcggtgctggttgccgacgtgccggtgcagatgtgcgccccctacaag
gcggccgccgacaagtttggcatcgacagcatctttatcgccccgcccaatggcgacgcc
gagaccctgaaacaggtggcggagctcggcaatggttacacctatctggtgagccgcgcc
ggcgtcaccggcgccgagaccaaggccggtatgccggtggaggggctgatcaataccctg
cgcgaattcaacgccccccccgccctgctcggctttggtatcagcgagccagctcaggtg
cgtgaagcgatcgcagctggcgccgccggtgccatctccggctccgccgtggtgaagatc
atcgagacccaccaccagaacccggaacatatgctgacccgcctgaaagagtttgtggaa
gggatgaaggctgcgaccaatcgataa

DBGET integrated database retrieval system