KEGG   Aeromonas veronii B565: B565_3045Help
Entry
B565_3045         CDS       T01462                                 

Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
avr  Aeromonas veronii B565
Pathway
avr00540  Lipopolysaccharide biosynthesis
avr01100  Metabolic pathways
Module
avr_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    B565_3045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:avr01005]
    B565_3045
Enzymes [BR:avr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     B565_3045
Lipopolysaccharide biosynthesis proteins [BR:avr01005]
 Lipid A
  B565_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep LpxD Hexapep_2 Fucokinase DHFR_1 DUF4954 Urocanase_C
Motif
Other DBs
NCBI-ProteinID: AEB51080
Position
complement(3443875..3444894)
Genome map
AA seq 339 aa AA seqDB search
MAFTLAQLAQQLGAQVHGDGTLEIRKVATLEKAGEGDITFLSNKKYRHYLEQSKATAVLI
TEADLPFCPTNALVLKDPYVGFARVAQLLDTTPQPATDIHPSAVIAADVQLGERVAIGAN
AVIESGVVLGDDVRIGPGCFVGKNTRLGARSRLWANVTLYHNVTMGTDCLVQSGTVIGAD
GFGYANERGEWIKIPQLGGVTIGNRVEIGACTTIDRGALEDTRIADNVIIDNQCQIAHNV
EIGYGTAVAGSTVMAGSLKVGKYCIIGGASVFNGHMEICDQATVTGMAMVMRPITEPGVY
SSGIPLQTNKEWRKTAARVMRIEEMHKRLSKLEKKLDQE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcattcactctcgcacagctggcccagcaactgggggcccaggtccatggcgacgga
accctggaaatccgcaaggtagcgacactggaaaaggccggggagggggatatcaccttc
ctgtccaacaagaagtaccggcactatctggagcagagcaaggcgaccgccgtgctcatt
acagaagcggatctgccattttgtcccaccaatgccttggtgctcaaagacccctatgtg
ggctttgcccgggtagcccaactgctggacaccaccccgcagccggccacggatattcat
ccgagtgccgttatcgcggctgacgtgcaactgggcgagagagtggccatcggcgccaat
gcagtgatcgaatccggtgtcgtgctgggtgacgatgtacgcattggcccgggctgtttt
gttggcaaaaatacccggctgggagcccgctcccggctgtgggccaacgtcaccctctat
cacaatgtgaccatgggtaccgactgtctggttcaatccggcacagtgatcggcgccgat
ggtttcggttatgccaacgagcgtggtgagtggatcaagatcccccagctcggcggtgtg
actattggcaaccgggtcgagatcggtgcctgtaccaccattgatcgcggtgcgctggaa
gatacccgcatcgctgacaacgtcatcatcgacaaccagtgccagatcgcccacaacgtg
gagatcggctatggcaccgccgtggcgggctctaccgtgatggctggtagtctcaaggtc
ggcaaatactgtatcattggcggcgcttccgtctttaacgggcatatggagatctgcgac
caggccaccgtcaccggtatggccatggtgatgcgacccattaccgagcccggtgtctac
tcttccggcatccctctgcaaaccaataaagagtggcgcaagaccgccgcccgggtgatg
cgtatcgaagagatgcacaagcggttaagcaagcttgagaagaagctggatcaagaataa

DBGET integrated database retrieval system