KEGG   Aeromonas veronii B565: B565_3377Help
Entry
B565_3377         CDS       T01462                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
avr  Aeromonas veronii B565
Pathway
avr00290  Valine, leucine and isoleucine biosynthesis
avr00660  C5-Branched dibasic acid metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01210  2-Oxocarboxylic acid metabolism
avr01230  Biosynthesis of amino acids
Module
avr_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    B565_3377
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    B565_3377
Enzymes [BR:avr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     B565_3377
    4.2.1.35  (R)-2-methylmalate dehydratase
     B565_3377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase
Motif
Other DBs
NCBI-ProteinID: AEB51412
Position
3799741..3801138
Genome map
AA seq 465 aa AA seqDB search
MAKTLYQKVFDAHVVREVEGETPLIYIDRHLVHEVTSPQAFDGLRAMNRQLRRPDLTWAT
MDHNVSTTTKDIAASGEMARIQMETLADNCKEFGIRLYDLNHKYQGIVHVMGPELGITLP
GTTIVCGDSHTATHGAFGSLAFGIGTSEVEHVMATQTLKQGRAKTMRISVNGKLAEGISA
KDVVLAIIGKVGHAGGTGYVVEFAGEAIASLSMEGRMTVCNMAIELGAKAGMIAPDQTTI
DYIRGKEFAPKGAALEQAIAYWQSLKSDEGARFDAEVVLDAADIAPQVTWGTNPGQVIAV
NEPIPAPESFSDLMEQQSARKALAYMDLQPGQKLSDVAIDKVFIGSCTNSRIEDLRAAAA
IARGRKVAAGVQALVVPGSEQVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLQP
GERCASTSNRNFEGRQGRAGRTHLVSPAMAAAAAVTGRFADIRAL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccctctatcagaaagtattcgacgcccacgtggtacgggaagtggagggg
gagacccccctcatctacatcgaccgccatctggtacatgaagtgaccagcccgcaggca
ttcgacggcctgcgcgccatgaaccgccagctgcgccgcccggacctgacctgggccacc
atggatcacaacgtctccaccaccaccaaggacatcgccgcctccggcgagatggcccgc
atccagatggagacgctggccgacaactgtaaagagttcgggattcgcctctacgatctc
aaccacaaatatcaggggatcgtccatgtgatgggccccgagctcggcattaccctgccc
ggcaccaccatcgtctgcggcgactcccacaccgccacccacggcgccttcggctcgctg
gccttcggcatcggcacttccgaagtggaacatgtgatggccacccagaccctgaaacag
ggccgcgccaaaaccatgcgcatttcagtcaacggcaagctggcggagggcatcagcgcc
aaggacgtggtgctggccattatcggcaaggtcggccatgccggtggtaccggctacgtg
gtggagtttgctggcgaggccattgcgagcctctctatggaagggcggatgacggtgtgc
aacatggccatcgagctgggcgccaaggcgggcatgatagcccccgaccagaccaccata
gactacatccgtggcaaggagttcgcccccaaaggcgcagcgctggagcaggccatcgcc
tactggcagagcctcaagagcgatgaaggtgcccgtttcgatgccgaagtagtgctggat
gccgccgatatcgccccgcaggtcacctgggggaccaatccgggtcaggtgattgccgtc
aatgagccgattccggcaccggaatccttcagcgatctgatggagcagcaatctgcccgc
aaggcactcgcctacatggacttgcaaccgggccagaagctctccgacgttgccatcgac
aaggtgtttatcgggtcgtgcaccaacagccgcatcgaggatctgcgcgccgccgccgcc
atcgctcgcggtcgcaaggttgccgctggcgtgcaggcgctggtggtgccgggttccgag
caggtgaaagcgcaggccgaagccgaggggctggacaagatcttcatcgaggccggtttt
gagtggcgcctgccggggtgctccatgtgtctggcgatgaacaacgaccggctgcaaccg
ggggagcgctgcgcctccaccagcaaccgcaacttcgaaggacgtcagggccgcgccggc
cgcacccatctggtcagcccggccatggccgccgccgccgccgtcaccggccgcttcgcc
gacattcgcgcactgtaa

KEGG   Aeromonas veronii B565: B565_3378Help
Entry
B565_3378         CDS       T01462                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
avr  Aeromonas veronii B565
Pathway
avr00290  Valine, leucine and isoleucine biosynthesis
avr00660  C5-Branched dibasic acid metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01210  2-Oxocarboxylic acid metabolism
avr01230  Biosynthesis of amino acids
Module
avr_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    B565_3378
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    B565_3378
Enzymes [BR:avr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     B565_3378
    4.2.1.35  (R)-2-methylmalate dehydratase
     B565_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AEB51413
Position
3801151..3801750
Genome map
AA seq 199 aa AA seqDB search
MTGFKQHKGIIVPLDSANVDTDAIIPKQFLQKVNRIGFGKHLFHDWRFLDDAGQQPNPEF
VLNQPQFAGASILLARENFGCGSSREHAPWALADYGFKTIIAPSFADIFYGNAINNGMVP
VRLKEEEVETLFQLVAAKPGIEIEVDLEANQVRAGSLCFGFEIDEFRRYCLLNGLDAIGL
TLQHEAAISAFEAKQPSWI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacaggattcaaacagcataaagggatcatcgtccccctcgacagcgccaacgtcgac
accgacgccattattccgaagcagtttttgcagaaggtaaaccgcatcggttttggcaag
cacctgttccacgattggcgcttcctcgacgatgccggccagcagcccaaccccgagttt
gtactgaaccagccgcaattcgccggtgccagcattctgctggcccgcgagaacttcggc
tgcggctcaagccgcgagcacgctccctgggcgctggcggactacggcttcaagaccatc
atagccccgagctttgccgatattttctacggcaacgccatcaacaatggcatggtgccg
gtgcgcctgaaggaggaggaggtcgaaaccctgttccagctggtggccgccaaaccgggc
atcgagatcgaggtggatctggaggctaatcaggtacgtgcaggtagcctctgcttcggt
ttcgagatcgatgaattccgccgttactgtctgctcaacggcttggatgccatcggtctg
accctgcagcacgaggccgccatcagcgcttttgaggcgaagcagccgagctggatttaa

DBGET integrated database retrieval system