KEGG   Aeromonas veronii B565: B565_3584Help
Entry
B565_3584         CDS       T01462                                 

Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase (Aminomutase), PLP-dependent
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
avr  Aeromonas veronii B565
Pathway
avr00860  Porphyrin and chlorophyll metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
Module
avr_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
avr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B565_3584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:avr01007]
    B565_3584
Enzymes [BR:avr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     B565_3584
Amino acid related enzymes [BR:avr01007]
 Aminotransferase (transaminase)
  Class III
   B565_3584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEB51619
Position
4022187..4023473
Genome map
AA seq 428 aa AA seqDB search
MSKSDQLFEQARQTIPGGVNSPVRAFNGVGGTPRFIDHADGAYLYDVDGQAYVDYIGSWG
PMLLGHNHPAIKAAIIKAVEKGLSYGAPTEIEVLMAEKVRQIVPSMEQVRMVNSGTEATM
SAIRLARGYTGRDKIVKFEGCYHGHADSLLVKAGSGALTLGQPNSPGVPADFAKHTLTCV
FNDLDSVREAFTQYGSEIACIIVEPVAGNMNCIPPIPGFLEGLRAICDEFGALLILDEVM
TGFRVSLRGAQGHYNIDPDLTTLGKIIGAGMPVGAFGGKKKVMQHIAPTGPVYQAGTLSG
NPVAMAAGLTMLDLLLEPGLYEQLSAKTARVAEGLKAAAAKHGIPLAINYVGGMFGFFFT
EESEITRYEQVTRCDMERFKRFYHLMLEEGVYLAPSAYEAGFLSLAHGDKEIEHTLAAAE
RSFAKLAD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatcagatcagctgtttgaacaggcccgccagaccattccgggtggcgtcaac
tcaccggtccgcgccttcaatggagtcggcggcacgccccgcttcatcgatcacgccgat
ggcgcctatctctatgatgtggatggtcaggcctacgtggattacatcggctcctggggc
cccatgctgctgggtcacaaccatccggccatcaaagccgccatcatcaaggccgttgag
aaggggctgagctacggtgcgccgaccgagatcgaagtgctgatggccgagaaagtgcgc
caaatcgtcccctccatggagcaggtacggatggtcaactccggcaccgaagccaccatg
agcgccatccgtctggcccgtggctacaccggccgcgacaagatcgtcaaattcgagggt
tgctaccacggccacgccgactccctgctggtcaaggcaggttccggcgccctgaccctg
ggtcaacccaacagcccgggcgttccggccgatttcgccaagcacaccctgacctgcgtc
ttcaacgatctggattcggtgcgtgaagccttcactcagtacggcagcgagatcgcctgt
atcatcgtcgaaccggtcgcaggcaacatgaactgcatcccaccgatccccggcttcctg
gaagggctgcgcgccatctgtgacgagttcggtgccctgctgatcctggacgaggtgatg
acaggcttccgcgtctccctgcgcggtgctcagggtcactacaacatcgacccggatctc
accacccttggcaagatcatcggtgccggcatgcctgttggcgccttcggcggcaagaag
aaggtgatgcagcacatagccccgaccggccctgtctatcaggcgggtactctctccggc
aacccggtggccatggctgccggtctgaccatgctggatctgctgctggagccgggtctc
tatgagcagctgagcgccaagacagctcgtgttgcagaagggctgaaagccgccgcggcc
aagcatggcattccgctcgccatcaactatgtgggcggcatgttcggcttcttcttcacc
gaagagagcgaaatcacccgctacgagcaggtcactcgctgcgatatggaacgcttcaag
cgcttctatcatctgatgctggaagagggcgtctatctggcgccgagcgcctacgaggcg
ggcttcctgtcactggctcacggcgacaaggagatcgaacataccctggctgccgccgag
cgcagcttcgccaagctggctgactaa

DBGET integrated database retrieval system