KEGG   Aeromonas veronii B565: B565_3923Help
Entry
B565_3923         CDS       T01462                                 

Definition
(GenBank) Glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00030  Pentose phosphate pathway
avr00500  Starch and sucrose metabolism
avr00520  Amino sugar and nucleotide sugar metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_3923
   00030 Pentose phosphate pathway
    B565_3923
   00500 Starch and sucrose metabolism
    B565_3923
   00520 Amino sugar and nucleotide sugar metabolism
    B565_3923
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avr04147]
    B565_3923
Enzymes [BR:avr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     B565_3923
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B565_3923
  Exosomal proteins of other body fluids (saliva and urine)
   B565_3923
  Exosomal proteins of colorectal cancer cells
   B565_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI Urease_beta
Motif
Other DBs
NCBI-ProteinID: AEB51958
Position
4418603..4420252
Genome map
AA seq 549 aa AA seqDB search
MKNINPTQTQAWQALEAHFAANKETRLKDLFAQDPKRFDKFSLTFGGDILVDYSKNLITE
ETLKLLVDLAKETDLRSAIDAMFNGDKINMTEGRSVLHVALRNRSDRPIECDGKDVMPEV
NAVLAKMKGFCEKIISGEWKGYTGKAIQHVVNIGIGGSDLGPVMITEALRPYKNHLQMHF
VSNVDGTHIAETLKKIDPETTLFLVASKTFTTQETMTNALTARDWFIKIAGDKAHVAKHF
AALSTNGKAVAEFGIDTNNMFEFWDWVGGRYSSWSAIGMPIALSVGFENFEALLQGAFEM
DMHFATASYEQNVPVLLALIGLWYNNFYGAESEAILPYDQYMHRFPAYFQQGNMESNGKY
VDRNGKPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLIPCDFLAPAISHNPIGDHHPKL
LANFFAQTEALAFGKSKEEVEAEFLAAGKTLEQVKDLVPFKVFEGNRPTNSILFKSLTPK
TLGALIAMYEHKIFVQGAIWNIFSFDQWGVELGKQLANKILPELGNNEAVTSHDCSTNGL
INTWKAWKA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcaatccaacccaaacccaggcctggcaggcactggaagcccactttgca
gcaaacaaagagactcgactcaaggatctgttcgcgcaggacccgaagcgctttgacaag
ttttcccttaccttcggcggcgacatcctggttgattactcgaagaacctgatcaccgaa
gaaaccctcaagttgctggttgatctggccaaagagaccgatcttcgcagcgcgatcgat
gccatgttcaatggcgacaagatcaacatgaccgaagggcgctccgtactgcacgtggcc
ctgcgcaaccgctccgaccgccccatcgagtgcgacggcaaggatgtgatgccggaagtg
aacgccgtgctggccaagatgaaaggcttctgcgagaagatcatctccggcgaatggaaa
ggctacaccggcaaagcgatccagcacgtggtcaacatcggtatcggtggctctgatctc
ggcccggtgatgatcaccgaggcactgcgtccctacaaaaaccacctgcagatgcacttc
gtctccaacgtcgatggcacccacatcgccgagaccctgaagaagatcgatccggaaacc
accctgttcctggtggcctccaagaccttcaccacccaggagaccatgaccaacgccctg
accgcccgcgactggttcatcaagatcgccggtgacaaggcccacgttgccaagcacttc
gctgccctctccaccaacggcaaggccgtggccgagttcggtatcgacaccaacaacatg
ttcgagttctgggactgggttggcggccgctactcctcctggtctgccatcggcatgccc
atcgccctgtctgtcggtttcgagaacttcgaagccctgctgcaaggcgccttcgagatg
gacatgcacttcgccactgcctcttatgagcagaacgtgccggtgctgctggcgctgatt
ggcctgtggtacaacaacttctacggtgccgagtccgaagccattctgccgtacgaccag
tacatgcaccgcttccctgcctacttccagcaaggcaacatggaatccaacggcaagtac
gtggatcgcaacggcaagccggttgactaccagaccggccccatcatctggggtgagccg
ggcaccaacggccagcacgccttctaccagctgatccatcagggcaccaagctgatcccc
tgtgacttcctggcaccggccatcagccacaacccgatcggtgaccaccatccgaaactg
ctggccaacttcttcgcccagaccgaggcgctggccttcggcaagagcaaggaagaggtt
gaagccgagttcctagcggctggcaaaaccctggagcaggtcaaggatctggtgccgttc
aaggtgttcgaaggcaaccgcccgaccaactccatcctgttcaagagcctgaccccgaaa
accctgggcgccctgatcgccatgtacgaacacaagatcttcgtacagggcgcaatctgg
aacatcttctccttcgaccagtggggcgtggagctgggcaaacagctggccaacaagatc
ctgccggagctgggcaacaacgaggctgtcaccagccacgactgctccaccaacggcctg
atcaacacctggaaagcgtggaaagcctga

DBGET integrated database retrieval system