KEGG   Aeromonas veronii B565: B565_3987Help
Entry
B565_3987         CDS       T01462                                 

Definition
(GenBank) Amidohydrolase
  KO
K01485  cytosine/creatinine deaminase [EC:3.5.4.1 3.5.4.21]
Organism
avr  Aeromonas veronii B565
Pathway
avr00240  Pyrimidine metabolism
avr00330  Arginine and proline metabolism
avr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    B565_3987
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    B565_3987
Enzymes [BR:avr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.1  cytosine deaminase
     B565_3987
    3.5.4.21  creatinine deaminase
     B565_3987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1 TatD_DNase
Motif
Other DBs
NCBI-ProteinID: AEB52022
Position
complement(4501421..4502686)
Genome map
AA seq 421 aa AA seqDB search
MLIQHIRLADREGLWQIRCQDGVITAIEPHDEHAVAGRVLDGEGGLAIAPFIEPHIHLDT
TQTAGEPSWNLSGTLFEGIERWAERKALLTHEDVKQRAIQTLKWQIANGIQFVRTHVDVS
DPNLVALKAMLEVREEMKEWVELQIVAFPQEGILSYPNGKALLEEALKLGADVIGAIPHF
EFTREYGVESLHYIFDLAEKYQVLVDVHCDEIDDEQSRFIETLATLAYERGIGHRVTASH
TTAMHSYNGAYASRLFRLLKMADINFVANPLVNIHLQGRFDTYPKRRGITRVKEMLEANI
NVCFGHDDVFDPWYPMGTANMLQVLHMGLHVCQIMGYEQINDGLKLISSHSARTLNVQDR
YGIEVGKPANLLILPADNGFDAVRRQVPVRYSIRHGKVIAQTRPAQTEIVLGQPEPIDFR
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctgattcaacatattcgtttggccgatcgggaagggttgtggcagatccgctgtcag
gatggggtcatcaccgccatcgaaccccatgacgaacatgccgtcgccggtcgggtgctg
gacggggagggcggtctggcgatcgctccctttatcgaaccccacattcacctcgatacc
acccagacggcgggcgagccgagctggaacctctccggcaccctgttcgaggggatcgag
cgctgggccgagcgcaaggcgctgctgacccatgaggatgtgaaacagcgcgccatccag
acgctgaagtggcagattgccaacggcatccagtttgtccgtactcacgtcgatgtctcc
gatcccaatctggtggcgctcaaggcgatgctggaggtgcgggaggagatgaaggagtgg
gtcgagctgcagatcgtcgccttcccgcaggaggggatcctctcctaccccaacggcaag
gcactgctggaggaggcgctcaagctgggggctgacgtgattggcgcgatcccccacttc
gagtttacccgggaatatggggtcgaaagtctgcactacatcttcgatcttgcggagaag
tatcaggttctggtcgatgtgcactgcgacgagatcgatgacgagcagtcccgtttcatc
gagacgctggcaaccctggcctacgagcggggtatcggtcatagagtcaccgccagccac
accaccgccatgcactcctacaacggcgcttatgcttcccgcctgttccggctgctgaag
atggcggacatcaacttcgtggccaatccgctggtgaacattcacctgcaggggcggttc
gatacctatcccaaacgccgcggcattacccgggtgaaggagatgctggaggcgaacatc
aacgtctgcttcggtcacgacgacgtgttcgatccctggtaccccatgggcaccgccaac
atgttgcaggtgctgcacatggggctgcatgtctgccagatcatgggctacgagcagatc
aacgacggtctgaagctgatcagcagccacagcgcccgcaccctgaacgtgcaggatcgt
tatggcatagaggtgggcaaaccggccaacctgttgatcctgcctgccgacaacggcttc
gatgcggtgcgccgtcaggtgccggtgcgttactcgatccgccacggcaaggtgattgcc
cagacccgtccggcccagaccgaaatcgtgctgggtcagccagagcccatcgattttcgc
cgctga

DBGET integrated database retrieval system