KEGG   Aerococcus viridans: AWM76_05465Help
Entry
AWM76_05465       CDS       T04270                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avs  Aerococcus viridans
Pathway
avs00071  Fatty acid degradation
avs00072  Synthesis and degradation of ketone bodies
avs00280  Valine, leucine and isoleucine degradation
avs00310  Lysine degradation
avs00362  Benzoate degradation
avs00380  Tryptophan metabolism
avs00620  Pyruvate metabolism
avs00630  Glyoxylate and dicarboxylate metabolism
avs00640  Propanoate metabolism
avs00650  Butanoate metabolism
avs00900  Terpenoid backbone biosynthesis
avs01100  Metabolic pathways
avs01110  Biosynthesis of secondary metabolites
avs01120  Microbial metabolism in diverse environments
avs01130  Biosynthesis of antibiotics
avs01200  Carbon metabolism
avs01212  Fatty acid metabolism
avs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWM76_05465
   00630 Glyoxylate and dicarboxylate metabolism
    AWM76_05465
   00640 Propanoate metabolism
    AWM76_05465
   00650 Butanoate metabolism
    AWM76_05465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWM76_05465
   00072 Synthesis and degradation of ketone bodies
    AWM76_05465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWM76_05465
   00310 Lysine degradation
    AWM76_05465
   00380 Tryptophan metabolism
    AWM76_05465
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWM76_05465
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWM76_05465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWM76_05465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avs04147]
    AWM76_05465
Enzymes [BR:avs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWM76_05465
Exosome [BR:avs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWM76_05465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMC01032
Position
complement(1132807..1133988)
Genome map
AA seq 393 aa AA seqDB search
MEEVVIVAAKRSAIGKFGGQFKGISAVELGVEVLKETLASIDLDPTKVEQVILGNVLSAG
LGQNVARQVALKSGLSNESTAVTINQVCGSGLRTVMMGAQAIMLGDADIVVAGGTENMTR
APYVVDSARWGQRMGNGQMIDTMLHDGLTDAFSNDAMGITAENIADQYGISREAQDEFAA
ASQVKAVAAKEADRFAEEIVPVTIQQKNGTQVVAEDEGPRSGITAKRLGKLQPAFKEEGT
VTAGNSSSINDGAAMLVLMSKRKADELGLKPMVSIASYATGGVDPSIMGTGPIPTTIKAL
EKANITAGDLDLIEANEAFASQALCVTTSLELPAEKVNVNGGAIALGHPIGASGARILVT
LIHEMQKRQSVYGLATLCVGGGQGVSVIVKQEV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtagtcattgttgcagcgaaacgttctgcaattggaaaatttggtggccaa
tttaaaggcatctcagcagttgaattaggggtagaagtattaaaagaaacactcgcttca
attgacttagacccaacaaaagttgaacaagtgatcttggggaatgtattaagtgcagga
cttggccaaaatgttgcgcgccaagtcgccctaaaatcaggtttgtctaatgaatcaact
gccgtaaccattaaccaagtttgtggttcaggattgcgtactgtcatgatgggcgcacaa
gctatcatgcttggtgacgctgatattgttgtcgcaggtggtacggaaaatatgactcgc
gcaccatacgtggttgattccgctcgttggggtcagcgtatgggtaacggtcaaatgatt
gacactatgctacacgatgggctaactgatgccttctcaaacgatgcgatggggattaca
gcagaaaatattgcggaccagtacgggatttcccgtgaagcccaagatgaatttgcagcc
gctagccaagtcaaggctgtagcagcgaaagaggctgatcgttttgcagaagaaattgtc
ccagtgactatccaacaaaaaaatggcacgcaagtggtggctgaagatgaagggccacgt
tcgggtattacagcaaaacgtttgggtaaattgcaaccagcctttaaagaggagggaaca
gtgacagcaggtaattcatcaagtatcaatgatggagcagcaatgcttgtcttgatgtct
aagcgtaaggctgatgaactagggcttaaacccatggtatctattgcttcttacgcaacg
ggtggggtagatccttctattatggggacaggcccaatcccaacaacgatcaaggcctta
gaaaaggccaatattacagcaggagacctagatttaattgaggccaatgaagcctttgca
tcccaagctttatgtgtaaccacaagcctagaattgccagctgaaaaggttaacgtgaac
ggtggggcaattgctcttggtcatccgattggtgcgtcaggcgcccgtatcttggtaact
ttgatccatgaaatgcaaaaacgtcagtcagtttatggtttagcgaccctatgtgtgggc
ggcggtcaaggggtatccgtcattgtaaaacaagaagtttaa

DBGET integrated database retrieval system