KEGG   Actinomyces tangfeifanii: BK816_01545Help
Entry
BK816_01545       CDS       T04541                                 

Definition
(GenBank) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
avu  Actinomyces tangfeifanii
Pathway
avu00730  Thiamine metabolism
avu00790  Folate biosynthesis
avu01100  Metabolic pathways
avu02020  Two-component system
Module
avu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:avu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BK816_01545
   00790 Folate biosynthesis
    BK816_01545
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BK816_01545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avu04147]
    BK816_01545
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:avu00537]
    BK816_01545
Enzymes [BR:avu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BK816_01545
Exosome [BR:avu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BK816_01545
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:avu00537]
 Enzymes
  BK816_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase SLH Metalloenzyme T4BSS_DotH_IcmK DUF2019
Motif
Other DBs
NCBI-ProteinID: AOZ72140
UniProt: A0A1D9MIY0
Position
409052..412795
Genome map
AA seq 1247 aa AA seqDB search
MSNLPSKQRRLAGVVAATATTALILAPSLASAFDPTMHKYNGPKACQALDKDGNVHALKP
GECAQFGKAGQGRTNARAKNVILIIGDGMGQQEITAARNYLKGAGSRFEGIDELPNTGMY
THHSVDLTGKVNYVTDSAASATAWSTGTKTYNGAISVDLEFNPVENLIEKAKLAGMRTGN
VTTSEIQDATPAAQIAHNVYRKCYGPDPVKNPSVCNKYNQYREQGGLGSISEQLIDTRPD
VTLGGGMKPFKQMVQADGEGKNPYLPNTTKWVKGKSVLDNAKDNGFQVVTTAEELKKIKK
ADQKQPVLGLFSEKNMKTRFASSKATLDAHLKEAKRCEKQDLGTEPELPLMASKAIELLD
DKTSDKGFFLQIESASIDKRNHASDACGMIGETERLDDVTKLALDFAKKDGNTMVIVTAD
HSHTAQIVYDSNPLVSPATRLLTADGAAMTVAYGTIPASLITGGTGSTTHTGAQLRVAGY
GPGSENVLGQTDQTDLHYTIANALGLNPDAGKGNVDGNLAAPVAAQNAAATCYLVNKDGK
VSAPAPGQCAQYGKDGQKRVADKAKNVILFIGDGMGDSEITIARNYLYGASGRLPGLDAL
PYTGNYTHYSLNKKTGLPDYVTDSAASGTAWATGTKTYNGGISVDNNGKPVANLIELAKA
KGLKTGNVTTAEIQDATPAVQGAHALNRKCYGPEEAKNSVSCQGEKFASQWRQNGGFGSI
SEQLVDTRADVTLGGGAKAFNQLVQVSGKWADHTWTAGTSVLDNAKANGFQVVTNAAELA
KVKVADQATPVLGLFSDGNLPRKYQKFYATVDGASKEAKTCEQNPERGQGVPDAAQMTRK
ALELLRNDKGFFLQVEAASIDKADHQADICGQIGETDDLDAAIQVARDWVKETGEPTLII
ATADHAHTSQIIPTQNEKAPISSGIVAKLATADGSEMMINYATAKSNDPKIAWGQQNHTG
TQLRIAAEGPGAQNVVGQLDQTDTHFLVANALGLYDKNPFELKNQFVPATTPEPTPEASV
EPSVEPTAETPEDQPIGQCVPRKVARAALEDPKLFKDVPTNRWFAPEIYWARGEGVTTGW
ADNTFRPLIGTTRADMAAFLYRLAGKPEIKVKNDQFKDVNDRTLFAREISWMKESGLSTG
WADGTYRPFDLVKRDAMAAFLERFVKAFPEKVSPAVAPETLSLDKINDPFVDVPEGMLHE
DAMKWIYAAGVATGWPDGTYRPLEPVSREAMIAFIYRLMYNTKAEGC
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatctgccaagtaagcaacggcgtctagcaggagttgtggctgccaccgctacc
accgctctaatcttggcgccaagccttgcctctgctttcgaccccacgatgcataaatac
aatgggccgaaggcatgtcaagcacttgacaaggacggaaatgtccacgctttgaaaccg
ggtgaatgtgcccagttcggtaaagcgggtcaaggccgaaccaatgcacgggccaagaac
gtcattttgattattggtgacggcatgggccagcaagaaatcaccgccgcccgtaactac
ctcaagggtgccggtagccgctttgaaggcattgacgaacttccaaacaccggtatgtac
acccaccactcggtggacctaaccggtaaggtcaactacgtgaccgactccgccgcctcg
gccaccgcttggtcgaccggtaccaagacctacaatggcgcgatttcggttgacctcgaa
ttcaacccagtcgaaaacttgattgaaaaggccaagttggctggcatgcgcaccggtaac
gtcaccacctcggaaatccaggacgccactccggcagcccagattgcccacaacgtctac
cgcaagtgctacggcccagacccagtcaagaacccatcggtttgtaacaagtacaaccag
taccgcgaacagggcggcctcggttcaatctccgaacagttgattgacacccgcccagac
gtcaccctcggtggcggtatgaagcccttcaagcagatggttcaggctgatggcgaaggc
aagaacccatacctaccaaacaccaccaagtgggtcaagggtaagtccgtcctcgacaac
gctaaggacaatggcttccaggttgtcaccaccgctgaggaactaaagaagattaagaag
gctgaccagaagcagccagttttgggcttgttctccgaaaagaacatgaagacccgcttc
gcttcctccaaggctactctcgacgctcacctcaaagaggccaagcgttgtgaaaagcag
gatctaggcaccgaaccagaactgccattgatggcctcgaaggcgatcgaactgttggat
gacaagaccagcgacaagggcttcttcctccagattgaatccgcctcgattgataagcgt
aaccacgcttctgacgcctgtggcatgatcggtgaaaccgagcgtctcgacgacgtcacc
aagttggccctcgacttcgctaagaaggacggcaacaccatggtgatcgttaccgccgac
cactcgcacaccgcccagatcgtttacgattcgaacccattggtttccccagccacccgc
ttgctcaccgctgacggtgctgccatgaccgtggcttacggtactatccccgccagcctc
atcaccggcggaaccggttcgaccacccacaccggcgcccagttgcgcgtagccggttac
ggcccaggctccgagaacgtcctcggccagaccgaccagaccgacttgcactacaccatt
gctaacgctctaggcctcaaccctgatgccggcaagggcaatgtggacggtaacctagct
gctccagtggccgctcagaacgctgccgccacctgctacttggtgaacaaggacggcaag
gtttccgccccagcccctggccagtgtgctcagtacggcaaggatggccagaagcgtgta
gccgacaaggctaagaacgtcatcctcttcattggtgacggcatgggcgacagtgaaatc
accatcgctcgtaactacctctacggcgcctccggtcgcctcccaggtttggacgcattg
ccttacaccggtaactacacccactactcgctcaacaagaagactggtttgccagactac
gtcaccgactcggccgcttcgggcaccgcttgggccaccggtaccaagacctacaacggt
ggtatcagcgttgacaacaatggcaagccagtggctaacttgatcgaattggctaaggcc
aagggtttgaagaccggtaacgttaccaccgctgaaatccaggacgccaccccggctgtc
cagggtgcacacgccctcaaccgtaagtgctacggccctgaagaagccaagaactcggtt
tcctgccagggtgaaaagttcgcttcgcagtggcgtcagaacggcggcttcggttcgatt
tcggaacagttggttgacacccgcgccgacgtcaccctcggtggtggcgctaaggccttc
aaccagctcgtacaggtttcgggtaagtgggcagaccacacctggaccgctggcacctcc
gtcctcgacaacgctaaggctaacggcttccaggtcgtaaccaacgcagcagaactcgcc
aaggtgaaggttgccgaccaggccaccccagtcctcggtttgttctccgacggcaacttg
ccacgtaagtaccagaagttctacgccacggtcgacggtgcttcgaaggaagccaagacc
tgtgagcagaacccagagcgcggccagggcgtgccagacgcagcccagatgacccgcaag
gcactagaactcttgcgtaacgacaagggcttcttcctccaggttgaagctgcgtcgatt
gacaaggctgaccaccaggctgacatctgtggccagatcggcgaaactgacgacctcgac
gcagccatccaggtggcacgcgactgggtcaaggaaactggcgaaccaaccttgattatc
gccaccgccgaccacgcacacacctcgcagatcattccaacccagaatgaaaaggcacca
atcagctccggtatcgtcgccaagttggctaccgccgacggctccgaaatgatgatcaac
tacgctaccgccaagtccaacgacccgaagatcgcatggggacagcagaaccacactggt
actcagctccgcatcgctgctgaaggtcctggcgcccagaacgtagttggtcagcttgac
cagaccgacacccacttcttggtggctaacgctctaggcttgtacgacaagaaccccttc
gaattgaagaaccagttcgtcccagccaccaccccagagccaaccccagaagcaagcgtc
gaaccatcggttgaaccaaccgcggaaaccccagaagatcagccaatcggccagtgtgtc
ccacgcaaggtcgctcgcgctgcccttgaggatccaaagttgttcaaggacgttcctacc
aaccgctggttcgccccagaaatctactgggcacgcggtgaaggcgtcaccaccggttgg
gccgataacaccttccgtccgctcatcggcaccacccgcgccgacatggctgccttcctc
taccgtttggctggcaagccagaaatcaaggtgaagaacgaccagttcaaggacgtcaac
gaccgtaccttgttcgctcgcgaaatctcctggatgaaggaaagcggcctatccaccggt
tgggccgacggtacctaccgtccattcgacctcgtcaagcgcgacgccatggctgcgttc
ctcgaacgcttcgtcaaggccttcccagaaaaggtttccccggcagttgccccagaaacc
ctctcgcttgacaagatcaacgacccattcgttgacgttcctgagggcatgctccacgag
gacgccatgaagtggatctacgcggcaggtgtggccaccggttggccagatggcacctac
cgtccactagagccggtgagccgcgaagcaatgatcgcgttcatctaccgcctcatgtac
aacaccaaagctgaaggctgctaa

DBGET integrated database retrieval system