KEGG   Actinomyces tangfeifanii: BK816_07660Help
Entry
BK816_07660       CDS       T04541                                 

Definition
(GenBank) tRNA lysidine(34) synthetase TilS
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
avu  Actinomyces tangfeifanii
Brite
KEGG Orthology (KO) [BR:avu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:avu03016]
    BK816_07660
Enzymes [BR:avu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     BK816_07660
Transfer RNA biogenesis [BR:avu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BK816_07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS QueC
Motif
Other DBs
NCBI-ProteinID: AOZ73185
UniProt: A0A1D9MLN1
Position
complement(1866128..1867321)
Genome map
AA seq 397 aa AA seqDB search
MTARPPISDVIGPNPTGAVRRVSLAIRQSLLRVSRDGQPQYAVVACSGGPDSMALAALTI
DVAASLKIPVHTVTIDHQIRPESSIEAEQVAATMRRLGAANASVVKVNLAAASRYGDASS
GPEGSARNARHAALERECRVLARAENARVYLLYGHTMDDQAETVLLGLGRGSGLRSLAGM
KLVAPPDDADQHQPWKLRPLLSVRRTDTELVCKHLGLPAVNDPTNAADGPWRCADGSALR
RAAVREFALPALAGALGKDPAPALLRTAWQMQRDNECLDQIAEALLADAECEVHDSTYTG
RRAKVDLDIEKLTNLHEAIVSRIVRLAALQAGANASALNSTQIDAMTALVLQYRGQGPVY
LPGGVVAARVRLDPPTPHGTPGLAQYDASAAIRLSFS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgaccacccatcagtgacgtcatcggccccaaccccaccggggcagtgcgt
cgcgtctcgctggcaatccgccaaagcctgctacgagtttccagagacggacaaccccaa
tatgcggtcgtggcctgttccggcggacccgactccatggcccttgccgcgctgaccatt
gatgtggccgcctccctgaaaatcccggtccacaccgtcaccatcgaccaccaaatccgc
cccgaatccagtatcgaggccgaacaagtggccgccaccatgcgccggctcggagccgcc
aacgcctcagtggtcaaagtcaacctggcggcagctagccgctatggtgatgcctcctcc
ggccccgaggggagcgcccgcaatgcccgccatgccgccctcgaaagagaatgccgcgtc
ctcgcccgcgccgaaaatgcgcgagtctacctgctttacggtcacaccatggatgaccaa
gccgaaaccgttctgttgggattgggtcgaggatcagggctgcgctcactcgccggcatg
aaactcgtcgccccaccagatgacgccgaccaacaccagccgtggaaactacggccactc
ctgtccgtgcgtcgcaccgacaccgaactcgtttgcaagcacctaggattgcccgccgtc
aacgacccaactaacgccgccgacgggccctggcgctgtgccgatggttccgccctgcgc
cgagctgccgtccgcgaattcgctttgcctgccctagctggcgccctcggcaaagatccc
gcccccgccctactacgcaccgcttggcagatgcaacgcgacaacgagtgcctggaccag
atcgccgaagcactcctagcggatgcggaatgcgaagtccacgactccacctacactggg
cggcgagccaaagtcgacctcgacatcgaaaagctcaccaacctgcacgaggccatcgtc
tcgcggattgtgcgactagcggcgctccaagctggggctaatgcctccgccttgaactcc
actcagatcgatgccatgaccgccctcgttctgcaataccgtggacaggggcccgtctac
ctgcctgggggagtcgttgccgcccgagttcgcctcgacccgccaaccccgcacggcacc
cccggcctggcccaatatgacgcctccgccgccattcgcctcagcttcagctag

DBGET integrated database retrieval system