KEGG   Actinomyces sp. VUL4_3: BK816_08765Help
Entry
BK816_08765       CDS       T04541                                 

Definition
(GenBank) hypothetical protein
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
avu  Actinomyces sp. VUL4_3
Brite
KEGG Orthology (KO) [BR:avu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BK816_08765
Enzymes [BR:avu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     BK816_08765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AOZ73349
UniProt: A0A1D9MMD2
Position
2141417..2142532
Genome map
AA seq 371 aa AA seqDB search
MSKLFSPLTLNLSEKQQTTVRNRLIMPPMCMYSADSEGPRVGLPNPFHLEHYGVRATSVG
QVVVEATGIRPDGRISPQCLCVSEDTRPEDFAPLATAIKEKGALAGIQLNHAGPKASELV
ASPRISPDSLSTSEISELVATWGHAAKLMAEAGFDFVQVHSAHGYLLHSFLSPYTNHRTD
EYGGMLENRARFVLQVLAEVGRYLPVAVRFSGTDWLGEDGLEIAEVEYVAQWAQALGVHQ
ISMSTGGIAPDASAIPVGPGYQVFAARQVRAAMDSMILPVHDLITDEVLEQRWNQTSEDD
ESAWRDYCAKVSAVGIILNGVQAESILATGAADLIEVGRPLLANPYLGFKWQAELGEEVE
LPRQYRRAVIV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactcttctccccactgactttaaacctttccgaaaagcagcagacaactgtt
cgcaatcgcctaatcatgccgccgatgtgcatgtatagcgccgattctgagggtccgcga
gtaggacttcctaaccctttccacctcgaacattacggggtacgcgcgacctcggttggg
caagtggtagtagaagccactggtattcgtcctgatggccgtatttctccgcagtgcttg
tgcgtcagtgaggatactcgtcccgaggattttgctcctttggccaccgcgattaaagaa
aaaggggccttggctggcatccagttgaaccacgccggaccgaaagcaagcgagttagtt
gcctcgccgcgcatctcccccgatagcctttcgacctcggaaattagcgaactggtggct
acttgggggcacgcagccaaactgatggccgaagccggtttcgattttgtgcaagtccac
agcgcccacggctacctgctgcacagtttcctttcgccttacaccaatcaccgcactgat
gaatacggtggcatgctagaaaatcgcgcccggtttgtcctgcaagtattggccgaggtc
ggtcgctacttgccggtcgccgtccgtttttcgggcactgactggttgggcgaagatggc
ctcgaaattgctgaagtggagtatgtggcccagtgggctcaagctttaggcgttcaccaa
atcagcatgtcaacgggcgggattgctcctgatgcttctgcgattcccgttggacccggc
taccaggtgtttgcggcccgccaggttcgagcagcgatggacagcatgatcctgccagtc
cacgacctaatcactgacgaggtgctggagcaacgctggaatcagactagcgaagacgat
gagagtgcctggcgggattattgcgcgaaagttagtgccgttgggattatcctcaatggc
gttcaggcggaaagcattttggcaactggggctgcggatctgatcgaggtcggtcgtccg
ctcctagcaaacccgtacctcggttttaaatggcaggcagaactgggcgaagaggtcgaa
ctgcctcggcaatatcgccgcgcagtgattgtttag

DBGET integrated database retrieval system