KEGG   Anabaena sp. wa102: AA650_20430Help
Entry
AA650_20430       CDS       T04059                                 

Definition
(GenBank) bile acid beta-glucosidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
awa  Anabaena sp. wa102
Pathway
awa00511  Other glycan degradation
awa00600  Sphingolipid metabolism
awa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AA650_20430
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AA650_20430
Enzymes [BR:awa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AA650_20430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-ProteinID: ALB42504
UniProt: A0A0K2M3K4
Position
4626714..4629113
Genome map
AA seq 799 aa AA seqDB search
MTNHPQIPPCTWKRPIGLGWEKPYTVRYPSNIDDGPWHGMPLGGFGAGCIGRSSRGDFNL
WHIDGGEHTFKTVPACQFSIFESGQAYALSTQPPEDHKLQSWQWYPPSPLSVDGLGSGTY
HALYPRSWFVYENVLKTQLTCEQFSPIWADNYQEASYPVAVFLWKAHNPTNTPITISIML
TWENMVGWFTNTLKSPEVRVRDDGSPVYEYLPRWGESQGNYNCLAEDHQYFGCVLGQVSN
SQTVQEGDGTWCIATTKNPQVEIFHHSRFNPVGNGEDVWQSFSANGSLPNYLDETPADEN
TRLGAAIAVRFTLQPGESLDVPFVLSWDFPVTEFAAGVNYYRRYTDFFGCNGENAWQIAT
TALKEYQNWRSLIENWQTPILEKSDLPDWFKMALFNELYDLTSGGTLWSAASEIDPIGQF
AVLECLDYRWYESLDVRLYGSFGLLMLFPELEKSVIRAFARAIPQSDDRTRIIGYYLTIK
SESPNAVRKIAGATPHDLGAPNEHVWEKTNYTSYQDCNLWKDLGCDFVLQVYRDFLFTGA
NDIQFLADCWDAIVQTLDYVKTFDLDGDSIPENSGAPDQTFDDWRLQGVSAYCGGLWLSA
LEAAIAISKILTNRRGAEDAEVEVQGSIYQGWLSQSKPIYQEKLWNGEYYRLDSDSGSDV
VMADQLCGQFYARLLSLPDIVPSDRALSALTKVYDSCFLKFQNGEFGAANGVLPNGLPEN
PNSTHPLEVWTGINFGLAAFLVQMNMKNEAMRLTEAVVRQIYDNGLQFRTPEAITANGTF
RASTYLRAMAIWGIYLLIP
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccacccccaaatacccccctgtacctggaaacgtcccattggcttaggctgg
gagaaaccctacaccgtccgttatcctagtaatattgatgatggtccctggcacggaatg
cctcttggtggctttggtgcagggtgtataggacgttcttcacggggagactttaacctg
tggcacattgacggaggagaacatactttcaaaaccgttcccgcttgtcaatttagtatt
tttgaatcgggacaagcttacgcattatctacccaacccccagaagatcataaactgcaa
tcttggcaatggtatccaccttctcccctctctgtggacgggttggggtcaggtacatat
catgcactttatccccgcagttggtttgtttatgaaaatgtcttaaaaactcaattaact
tgtgagcaattttcgccaatttgggcagataattatcaagaagcaagttatccggttgcg
gtttttttgtggaaagcgcacaaccctacaaatacaccaattactattagcattatgcta
acttgggaaaatatggtgggttggtttaccaatactttgaaatctcccgaagttagagtt
agagatgatggtagtccagtttatgaatatctaccacgttggggagaaagtcaaggaaat
tataattgtttagcagaagatcatcaatattttggttgcgttttaggtcaagtttctaat
agtcaaactgttcaagaaggagatggaacttggtgtattgcgactactaaaaatccccaa
gtggaaatatttcatcattcccgatttaatcctgtgggtaatggtgaagatgtttggcaa
agtttctctgcaaatggttctttacctaattatctagatgaaactcccgcagatgaaaat
actcgtttaggtgcagcaattgcggtgcgttttactttgcaacctggggaaagtttggac
gttccttttgtattaagttgggatttccccgttacggaatttgcagcgggggtgaactat
taccgcagatatacagacttctttggttgtaatggtgagaatgcttggcagattgccact
actgctcttaaagaatatcagaattggcgatcgctcatcgaaaattggcaaacccccatt
ttagaaaaatcagacttacctgactggttcaaaatggctttattcaacgaactctacgat
ttaaccagcgggggaactctctggagtgccgcctcggaaattgatcccattggtcaattt
gccgtgttagaatgtttagattaccgttggtacgaaagtctagatgtgcggttatacggt
tcttttggattattgatgttattcccagaattggaaaagtcggtaattcgcgcctttgct
agagcaattccccaaagtgatgacagaactagaattatcggttattatctgactatcaaa
tcggaaagtcctaacgcagttcggaaaattgccggtgcgacaccccacgatttaggcgca
cccaatgaacacgtttgggaaaaaaccaattatactagttatcaagattgcaacctgtgg
aaagatttaggttgtgactttgttttgcaggtatatcgagattttctgtttaccggtgca
aatgatatccagtttttagcagattgttgggatgctattgtccaaactctcgattatgtg
aaaacttttgatctcgatggtgacagtataccagaaaattctggcgcacctgaccaaact
ttcgatgattggcgcttgcaaggtgtcagcgcttattgtggtggtttgtggttatctgct
ttggaagctgctattgctatttctaagattttaacgaaccgcagaggcgcagaggacgca
gaggtggaggtgcaagggtctatttatcaaggttggttaagtcaatcgaagccaatttat
caggagaagctttggaatggtgagtattaccgtttggatagtgacagtggttctgatgta
gttatggctgaccaattgtgtgggcaattttacgctcgcctattgagtttaccagatatt
gtgccgagcgatcgcgctttgtctgccttaacaaaagtatatgattcctgttttctcaag
tttcaaaatggtgaatttggcgctgctaatggtgttcttcccaatggtttacccgaaaat
cccaattctactcatcctttggaagtttggacgggaatcaattttggtctagcagctttc
ctggtgcaaatgaacatgaaaaatgaggcaatgcggttaactgaggctgtggtgaggcaa
atttacgacaatggtttgcaatttcgcaccccggaagcaatcaccgctaatggcactttc
cgcgctagtacctatctccgcgctatggctatttggggaatttatttactaattccttaa

DBGET integrated database retrieval system