KEGG   Aliivibrio wodanis: AWOD_I_0575Help
Entry
AWOD_I_0575       CDS       T03808                                 

Gene name
rlmM
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
awd  Aliivibrio wodanis
Brite
KEGG Orthology (KO) [BR:awd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:awd03009]
    AWOD_I_0575 (rlmM)
Enzymes [BR:awd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     AWOD_I_0575 (rlmM)
Ribosome biogenesis [BR:awd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AWOD_I_0575 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN GP67
Motif
Other DBs
NCBI-ProteinID: CED70669
UniProt: A0A090KGB5
Position
1:696157..697248
Genome map
AA seq 363 aa AA seqDB search
MKQVMFYCRSGFEKECAGEIQDKATQLEVFGFPRLKNNTGYVLFECYQEGDADKLIREIK
FNELIFARQMFAVATELSDLPSEDRISPILNALVDVENLPCCGDIRIETPDTNEAKELLK
FCRKFTVPMRIALRGKEMLTPRDSDRIPVMHICFIAPGHCYVGYSYTNNNSTFFMGIPRL
KFPSDSPSRSTLKLEEAFHVFIPRDEWDDRLASGMWAVDLGACPGGWTYQLVKRSMFVHA
IDNGMMAQSLMDTGQVKHHMVDGFKFEPQRKNVTWIVCDMIEKPARVAHLMGEWLIKGWA
KEALFNLKLPMKGRYDEVLQDIENLKEFLKKNNFQYKLQAKHLYHDREEITVHIQAISNI
SPH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaagtaatgttctattgtcgctctggttttgagaaagagtgtgcaggtgagatc
caagataaagccactcaacttgaagtgtttggttttcctcgcctaaaaaataatacaggc
tatgtgctatttgaatgctaccaggaaggcgatgcagataaattgatccgtgagattaaa
tttaatgagctgatttttgctcgtcaaatgtttgcggtagcaactgaattaagtgattta
ccttctgaagatcgtatctcaccaattttgaatgcattagttgatgttgaaaatttacca
tgttgtggtgatattcgtattgaaacacctgatacgaatgaagcaaaagaattattgaaa
ttctgtcgtaaatttacagtaccaatgcgtatcgcattacgtggtaaagagatgctaaca
ccaagagattcagatcgaatccctgttatgcatatttgctttattgcaccgggtcactgt
tatgtaggttattcttacaccaacaataattcaacgttctttatggggatcccgcgccta
aagttcccttcagattcaccaagccgttctacattgaaattggaagaagcatttcatgta
ttcattccgagagatgagtgggatgaccgtttggcttctggtatgtgggctgttgactta
ggtgcttgtccaggtggttggacttaccaattagttaagcgttctatgtttgttcatgcg
attgataatggcatgatggcacaaagcttaatggatacaggtcaagttaagcaccacatg
gttgatggctttaagtttgaaccacaacgaaagaacgtaacgtggatcgtgtgtgacatg
attgaaaagcctgcacgagttgcacaccttatgggtgaatggttaattaaaggttgggct
aaagaagctctatttaaccttaaattaccgatgaaaggccgttacgatgaagtacttcaa
gatattgaaaacttaaaagagtttttgaagaagaataacttccaatacaagcttcaagca
aagcacttgtatcatgaccgtgaagaaatcacagttcatatccaagcgatttctaatatt
tctcctcactaa

DBGET integrated database retrieval system