KEGG   Aliivibrio wodanis: AWOD_I_2130Help
Entry
AWOD_I_2130       CDS       T03808                                 

Definition
(GenBank) putative glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
awd  Aliivibrio wodanis
Pathway
awd00270  Cysteine and methionine metabolism
awd00480  Glutathione metabolism
awd01100  Metabolic pathways
Module
awd_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:awd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AWOD_I_2130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWOD_I_2130
Enzymes [BR:awd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AWOD_I_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase DUF2695
Motif
Other DBs
NCBI-ProteinID: CED72193
UniProt: A0A090ISA4
Position
1:complement(2439316..2440773)
Genome map
AA seq 485 aa AA seqDB search
MNTEQKSFVSQQIIEDACEWAIMHGVAFRQADNTARHCPFSIAPMTIEREVYQHLLTVMP
LITKLINNVSEDHDFLQASLGHMAKADPFFGRLMSLHSTLHNDVNNYTAARKPLLLMRTD
FMDDRNHGAKVIEFNGIAAGMGPFGQRATEFHLFMKNQWPDTYNQWIEDPSATSADNHGL
EQLAYGIAIAARAVNSDFNDQSKPTFLMVVQKNEDNVYDQHLLEVELQKQGVRTVRRTFE
QLSTQLSSGENKRLLLDNVGAIDVVYLRAGYQYEDYFSPELNESECCHTLSQTRLLIEQH
HVAVNATISQQLATSKTMQMRLTMMPEAEYSRWGLTLEEATLVKSVLADMKPVNNETITW
FNSEAKQEEWVLKNQGEGGGHCVFGQDISAKLSQLMSEEYDAWALMQRLYPHERETPTIA
VRDGEQTIVNDLVSEIGLFTAYYNGNPVTEFEGYAGYLIRSKPASENEGGIHSGKGILDS
LVLID
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaacaaaaatcgtttgtttctcagcaaataattgaagatgcctgtgaatgg
gcaattatgcacggtgtggcctttcgacaagcagataatacggcacggcactgtccattt
agtattgcaccaatgaccattgagcgtgaggtttatcagcacttattaaccgtgatgcca
ttaatcacgaagcttattaataacgtgtctgaagatcatgattttctgcaagcgtcattg
ggtcatatggccaaagcggatcctttttttggtcgcttaatgtcactacacagtacgcta
cataatgatgtaaataactacaccgccgctcgtaaacccttattattaatgcgtactgat
ttcatggatgatcgaaaccatggtgcgaaagtaattgaatttaatgggattgcggcaggc
atggggccttttggtcaacgtgctactgagtttcatttatttatgaaaaaccaatggccg
gatacctataatcaatggattgaagatccatcagccacttctgctgataatcatggttta
gagcaattggcctatggtattgcgattgctgcaagagcggttaattcggattttaatgat
caaagtaaacctacatttttgatggtggttcaaaagaacgaagataacgtatacgaccaa
catttgcttgaagttgagctgcaaaaacaaggtgtacgcacggtaagacgcacgtttgaa
caactcagcactcagctgtctagtggtgaaaataaacgtctgttattagataatgttgga
gctattgatgtggtgtatctgcgtgcgggttatcaatatgaggactatttctcaccagaa
cttaatgagtcagaatgttgccatacgttaagccaaacccgattgcttattgagcagcat
catgtcgcggtgaatgcaaccatcagtcagcaattagcgaccagtaaaacaatgcaaatg
cgattaaccatgatgccagaagcggaatattcgcgctggggattaaccctcgaagaggcg
acattggtaaaaagtgttttagctgatatgaagcctgttaataacgaaaccatcacatgg
tttaactcagaagcaaagcaagaagagtgggtattaaaaaaccaaggtgaaggtggtggt
cattgtgtctttgggcaggacatcagtgcgaaattaagccaattgatgtcagaggaatat
gatgcatgggcgttaatgcaacgtttatatccacacgaacgtgaaacgccaaccattgcg
gttcgtgatggagagcagacaatcgtaaatgatttagttagtgagattggtttatttacg
gcctattacaatggaaatccagtaacagaatttgaagggtatgccggatatttaattcgc
agtaagcctgcaagtgagaatgaaggagggatccacagtggaaaagggatccttgattct
ttggtgctaattgattaa

DBGET integrated database retrieval system