KEGG   Acetobacterium woodii: Awo_c01700Help
Entry
Awo_c01700        CDS       T01732                                 

Gene name
acoC1
Definition
(GenBank) TPP-dependent acetoin dehydrogenase complex E2 component dihydrolipoamide acetyltransferase AcoC1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
awo  Acetobacterium woodii
Pathway
awo00010  Glycolysis / Gluconeogenesis
awo00020  Citrate cycle (TCA cycle)
awo00620  Pyruvate metabolism
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo01130  Biosynthesis of antibiotics
awo01200  Carbon metabolism
Module
awo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c01700 (acoC1)
   00020 Citrate cycle (TCA cycle)
    Awo_c01700 (acoC1)
   00620 Pyruvate metabolism
    Awo_c01700 (acoC1)
Enzymes [BR:awo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Awo_c01700 (acoC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFA46979
UniProt: H6LFN4
Position
complement(189563..190879)
Genome map
AA seq 438 aa AA seqDB search
MAQLIVMPKFGLTMTEGTIASWNVAVGDTISEGDILCEIETDKLTNEFESPRAGVLLKII
ATEGSEIPCLEPIAIVGEANEDISGLLSDAPTCEAKTDEPVSTTPATTAATAGNATDGRV
KASPLAKKLAKEKGLDLQLVIGTGNNGSITVDDVKNYTPASQAADNLTVSPVAKKMAATA
GIDLTTINRDGRIMKKDVEPLLSGVHSTEAAPESIVLKGMRKTIAKRMSESWSTSPRVTY
TRPVDATALKEFRSKLKPEFNKRGLKLTFNHIMMKICAQTLLEFPHINGSLVDNTLILHP
HVHIGLAIGLDSGLLVPNVKNCDLKSLSQIAQETEQLIAEAKAGRTNMDDLTGGTFTLSN
LGAYGITSFSPIINQPELAILGIDAMVDTPVVIDSQIVIRPIMNLSLTADHRIIDGALAA
QFLQRLAEYLENPALLSV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattaatcgttatgcccaagtttgggctgacaatgacagaaggcaccattgcc
agttggaatgtcgccgttggtgataccatttctgaaggtgatattttatgtgaaatcgaa
accgataagttaaccaatgaatttgaatccccgcgcgccggggtgttattaaaaattatt
gccaccgaaggttctgaaatcccttgtctggaaccgattgccattgttggtgaagccaat
gaggatatttccgggttattatctgatgctcccacttgtgaagcaaaaaccgatgagccc
gtttctactacacctgcaaccaccgctgccacggctggcaacgcaaccgatggccgcgtt
aaagcctcacccttagccaaaaaactagccaaagaaaaagggctcgacctgcaattagtg
attggcactggcaacaacggcagcatcaccgttgacgatgttaaaaactacacccctgcc
agccaagccgctgacaacttgaccgtttctccggttgctaaaaaaatggctgctaccgcc
ggcatcgatttgacaaccataaaccgtgatggccgcatcatgaaaaaagatgttgaacct
ttattaagcggtgttcattcaactgaagccgccccggaatcaattgttcttaaaggcatg
cgcaaaaccattgcgaaacgcatgagcgaaagttggagcacctcaccccgggttacctat
acccgcccggtcgatgccacggcgctaaaagaattccgcagcaaattaaaaccggaattt
aacaaacgcggtctcaaactgaccttcaaccacattatgatgaaaatctgtgcccaaacc
ttgttggagtttccgcatattaacggcagcctggttgacaataccctgattcttcatccc
catgttcatattggcttggccatcggtttagattccggtctgctggttcccaatgtcaaa
aactgcgaccttaaatcactttcacaaattgcccaagaaaccgaacaactgattgccgag
gccaaagctggccgcaccaatatggatgatctgaccggaggaacctttaccttgtcaaat
ttgggcgcttatggtattacctctttttcaccgatcatcaatcaaccggaattagctatt
ctgggcattgatgcgatggttgatacgcccgttgtgattgattctcagatcgtcattcgt
cccatcatgaacctgagtctcaccgctgaccaccgcatcattgacggggctttagctgct
cagttcctgcaacgtttggccgaatatctcgaaaatccggctttattatcggtttaa

DBGET integrated database retrieval system