KEGG   Acetobacterium woodii: Awo_c09600Help
Entry
Awo_c09600        CDS       T01732                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase MurD
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
awo  Acetobacterium woodii
Pathway
awo00471  D-Glutamine and D-glutamate metabolism
awo00550  Peptidoglycan biosynthesis
awo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Awo_c09600 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Awo_c09600 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:awo01011]
    Awo_c09600 (murD)
Enzymes [BR:awo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Awo_c09600 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:awo01011]
 Precursor biosynthesis
  Amino acid ligase
   Awo_c09600 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFA47748
UniProt: H6LCG6
Position
1120795..1122156
Genome map
AA seq 453 aa AA seqDB search
MRKTTLVIGAARSGVAVSELLLKRGETVVLTDTRASGIVHKEFPQILEYEKYAQFESIFG
IQPSPEILNSIDEVVVSPGVPLIIPIIQAAYQQGIPVIGEVEAAYRLTRTPFIAITGTNG
KTTTTTLLGEIFKASGRGTYVVGNIGDPITNYVRAAKDIEVFVTEISSFQLETIDTFRPR
AAAILNLTPDHLDRHLTMENYVKAKGRIFENQTNEDLLVLNGDDPLVCQLAEKAVSQKAF
FSYQKKVAYGAWCLNGEIYINDRKNVIFVCREDELGIIGPHNTMNALVALTLAYLSGVEL
DVIIRVLKSFSGVEHRLEMVGCFSGVTYINDSKGTNTNATITALNAVKEPIILLAGGYDK
KEDYSELMELVAKRVKRLIVLGVTADDLIKAANAKGFTAITKVETYEEAVSCAKAEAVPG
DTVLLSPACASWDMFDNYEIRGRVFKKLVTENQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacgactttagtgattggggccgccagaagtggggtagcggtaagtgaatta
ttattaaaacgcggagaaacggttgtcttaaccgatacccgggcatccggcattgtccac
aaagagtttccccaaatattagaatatgaaaaatacgctcaatttgaatcaatctttgga
attcagccgagtccggagattcttaatagtattgatgaggtcgttgtgagtccgggtgtg
ccattaattattcccattatccaagcggcctatcaacagggtattcctgtcattggagag
gttgaagcggcctatcgattgacaagaacaccttttattgcgattaccggaacaaatgga
aaaacaacaacaacgactttattaggcgaaatatttaaagcctcaggaagaggcacttat
gtagttggaaatattggtgatccaattactaattatgtcagagcggcaaaagatattgaa
gtgtttgtcactgaaatcagcagttttcagttggaaaccatcgatacctttcggcccaga
gcggcggctattttaaatttaacacctgaccatttggatcgtcatttaacgatggaaaat
tatgtcaaagccaaaggacggatttttgaaaatcagacgaatgaggatttactggtttta
aatggtgatgatccattagtatgtcagttggccgaaaaagccgtttcccaaaaagctttt
tttagttatcaaaagaaggtagcctatggggcatggtgtttaaatggagaaatctatatc
aatgatcgaaagaacgtcatttttgtttgtcgcgaagatgagcttggcataattggcccg
cataatactatgaatgccctggtagcgttgaccctggcttatttatctggcgttgaattg
gacgttattatccgggtccttaaatcctttagcggggttgagcatcggctggaaatggtt
ggctgtttttccggcgttacttatattaatgattccaaagggactaataccaatgctact
attacagcgctcaatgcggttaaagaacccattattttattagctggcgggtatgacaaa
aaagaagattattcagaactgatggagttagtggctaaacgcgtcaaacggcttatcgtt
ttgggagtgactgcagatgatctgattaaagccgccaatgccaaaggttttacggccatc
actaaagtggaaacctacgaagaagcggttagctgtgccaaagctgaagcggtgccgggc
gatacggtgttattatcaccagcttgcgcaagttgggatatgtttgacaattatgaaatc
cgtggacgcgtttttaaaaagttggtaactgaaaatcaataa

DBGET integrated database retrieval system