KEGG   Acetobacterium woodii: Awo_c10730Help
Entry
Awo_c10730        CDS       T01732                                 

Gene name
acsE
Definition
(GenBank) methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
awo  Acetobacterium woodii
Pathway
awo01100  Metabolic pathways
awo01120  Microbial metabolism in diverse environments
awo01200  Carbon metabolism
Brite
Enzymes [BR:awo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     Awo_c10730 (acsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFA47859
UniProt: H6LD20
Position
1241757..1242542
Genome map
AA seq 261 aa AA seqDB search
MSKFMVIGERIHCISPAIRQAFADRNPEPILLRAKEQLDAGADYLDLNIGPAEKGGEELM
QWGVKLLQENFDNVPIALDTANMKAIEAGIQVYNRSKGKPIVNSADAGDRIEYVDLAAAN
DAMVIALCSKEGVPANNDERIAYCSELLERGMERGMEPTDLLFDPLFIVIKGMQDQLGDV
LEAIQMITDMGLLTTGGLSNVSNGAPKHIRPLLDSATVAMAMQCGFSSAIVNPCDKRLME
TIVACDIIKNNILYADSVLEF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattcatggttattggtgaaagaattcactgtatttctccagcaattagacaa
gcattcgcggacagaaatcctgaaccaattcttttaagagcaaaagagcaattagatgct
ggtgcagattatttggatttaaacatcggacctgctgaaaaaggcggcgaagagttaatg
caatggggtgtaaaattacttcaggaaaactttgataatgtaccaattgcactcgatacc
gctaacatgaaagcgattgaagctggtattcaggtttataaccgttccaaaggaaaacca
atcgtaaactctgccgatgctggggatcgaattgaatatgttgatttagcagctgctaac
gacgcaatggttattgctctttgttcaaaagaaggcgtaccagcaaataacgacgaacgt
attgcttactgttcagaattattggaacgtggaatggaacggggaatggaaccaactgat
ttattatttgatccattattcatcgttatcaaaggaatgcaagatcaattaggcgacgtt
ttagaagcaattcaaatgattactgacatgggcttgttaacaacgggtggattaagtaat
gtatctaacggtgcaccaaaacatattcgtccattattagatagcgcaacagtagcaatg
gcaatgcaatgtggatttagttctgcgattgttaatccttgtgacaaacgattaatggaa
accattgtagcttgtgatattatcaaaaataatatcctttatgcagattcagttcttgag
ttctaa

DBGET integrated database retrieval system