KEGG   Acetobacterium woodii: Awo_c24510Help
Entry
Awo_c24510        CDS       T01732                                 

Gene name
tpiA2
Definition
(GenBank) triosephosphate isomerase TpiA2
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
awo  Acetobacterium woodii
Pathway
awo00010  Glycolysis / Gluconeogenesis
awo00051  Fructose and mannose metabolism
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo01130  Biosynthesis of antibiotics
awo01200  Carbon metabolism
awo01230  Biosynthesis of amino acids
Module
awo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
awo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c24510 (tpiA2)
   00051 Fructose and mannose metabolism
    Awo_c24510 (tpiA2)
   00562 Inositol phosphate metabolism
    Awo_c24510 (tpiA2)
Enzymes [BR:awo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Awo_c24510 (tpiA2)
Exosome [BR:awo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Awo_c24510 (tpiA2)
  Exosomal proteins of bladder cancer cells
   Awo_c24510 (tpiA2)
  Exosomal proteins of melanoma cells
   Awo_c24510 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFA49208
UniProt: H6LDP4
Position
complement(2874654..2875391)
Genome map
AA seq 245 aa AA seqDB search
MRKPIIAGNWKMNNDIFETEKLMNTLLPLVAGAEAEVVFCPTYLGLQKAVEMAKDSNVGI
GGQNMHYEKSGAFTGEVSGEMLKAIGVDYVIIGHSERREYFNETDEAVNKKAIKALSLGI
TPIVCCGETLAERESGKAEAKIVGQIEAGLKGIEEITKVVVAYEPIWAIGTGKTASKEEA
NEACGWVRQTIAKMFGEDAAQKVRIQYGGSVNPENVKALMAMENIDGALVGGAALKASFA
EIVKF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaccaatcattgccggaaactggaaaatgaataacgatattttcgaaaccgaa
aaattaatgaataccctgttaccactggtagctggtgcagaagcggaagtggtattttgt
cccacctatttaggtttacaaaaagcagtggaaatggctaaagattccaacgtgggaatt
ggcggacaaaatatgcactacgaaaaaagcggtgctttcaccggggaagtatccggcgaa
atgctcaaagcgatcggggttgattatgtaatcattgggcattccgagcgacgggaatat
tttaatgaaaccgacgaagcggttaacaaaaaagccattaaggcactttctttagggatc
acaccgatagtttgttgtggtgaaacgctggcagaacgtgaaagtgggaaggctgaagcg
aagatcgttgggcaaatcgaagccggattaaaaggcattgaagagataacgaaagttgtt
gttgcctacgaaccgatctgggctattggcactggcaaaacagcgagtaaagaagaagcc
aatgaagcttgtggttgggttcgacaaacaattgccaaaatgtttggtgaagatgccgct
caaaaagttcggattcaatatggtggtagtgttaatcccgaaaatgttaaagcattgatg
gcgatggaaaatattgacggtgctttggttggcggagccgcactaaaagcaagttttgcg
gaaatcgtgaagttttaa

DBGET integrated database retrieval system