KEGG   Acetobacterium woodii: Awo_c25720Help
Entry
Awo_c25720        CDS       T01732                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
awo  Acetobacterium woodii
Pathway
awo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:awo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Awo_c25720 (recR)
DNA repair and recombination proteins [BR:awo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Awo_c25720 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Awo_c25720 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Prok-RING_4 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AFA49329
UniProt: H6LE96
Position
complement(3015308..3015907)
Genome map
AA seq 199 aa AA seqDB search
MGYYPKTLERLVLELGKLPGIGEKSAQRLAFHIINLSEEEIASLSEALVLAKSKIVLCKK
CFNITDKDICDICENPKRDQETICVVQSSRDIFAIEKAREYNGLYHVLHGAISPLDGIGP
QDIKARELLLRIGENEIKEVIMATNATVEGEATAMYLGNLISPLGVKVTRLAKGIPIGAD
LEYTDEITLIKAFEGRSKI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggatattacccaaaaacccttgaacgactcgttttagaactgggaaaattgccgggg
attggtgaaaaatccgcccaacggttggcttttcacattatcaatctttctgaagaagaa
atagcaagtctttccgaagcacttgttttggccaagtcaaaaatcgtgttatgtaaaaaa
tgttttaatattaccgataaagatatttgcgatatttgtgaaaatcccaaacgagatcag
gaaacgatttgtgtggtgcagagcagccgagatatttttgcaatcgaaaaagcccgcgaa
tacaatggtctctatcatgttttacatggtgccatttcaccccttgatggaatcggtcca
caggatataaaagcccgggagttattgttacgtatcggcgaaaatgaaataaaagaagtt
attatggctacgaatgctacggtggaaggtgaagcaacagctatgtatctgggcaatctg
attagtccgttaggagttaaagttacccgattggcgaaaggaatccctattggtgcggac
cttgagtatacagatgaaatcacattaattaaggcctttgaaggaagaagtaagatttaa

DBGET integrated database retrieval system