KEGG   Acetobacterium woodii: Awo_c30210Help
Entry
Awo_c30210        CDS       T01732                                 

Gene name
cbiP
Definition
(GenBank) cobyric acid synthase CbiP
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
awo  Acetobacterium woodii
Pathway
awo00860  Porphyrin and chlorophyll metabolism
awo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Awo_c30210 (cbiP)
Enzymes [BR:awo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Awo_c30210 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA DUF1611 GATase DJ-1_PfpI SNO
Motif
Other DBs
NCBI-ProteinID: AFA49749
UniProt: H6LI49
Position
complement(3475466..3476968)
Genome map
AA seq 500 aa AA seqDB search
MAKNIMFMGTGSSVGKSLVTAAMCRILDNHGYQVAPYKSQNMALNSFITEDGKEMGRAQV
VQAECARIEPQVEMNPVLLKPNSDVGCQVILMGKAEFNMDAMDYHAHKPKLVEIVVSAYE
TLAKEKDVIVIEGAGSPAEINLRDNDIVNMGLAELVDAPVVLIGDIDKGGVFASIYGTIM
LLEPEEQKRVKGFIINKFRGDVELLKPGIKMIEEKINIPCLGVIPYKRFVIDDEDSVTER
FDKHTEGLITIGVVYLPHLSNFTDCTAFEMHPDVNVEYYRNQRELQLANPDLLVIPGSKN
TIDDTCHVIESKMGEEIRRIHDCGVPIVGVCGGYQLLGKEIRDPLQVESTKGSIAGLGLL
NIVTTIGAEKRTVRTTGKVQGDFMGMALVDLAVEGYEIHMGESQALDNAKPFAILADGTV
DGVIAEDGTVMGTYLHGIFDNDAFREKIIETLRSKKNLAAGPAAFDFKAFKNEQYDLLAE
TVEASLDMKKIMGIIGEIEN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaatattatgtttatgggcaccggttcttcagttggaaaaagtcttgtaact
gcagccatgtgtcgaattttagataatcacggttatcaggtggcaccctacaaatcgcag
aatatggcacttaattcatttatcactgaagatggcaaagaaatggggcgggcccaggtt
gttcaggccgagtgcgcccggatcgaacctcaggttgaaatgaatccggtgttactaaaa
ccgaactccgatgttgggtgtcaggtgattttgatgggcaaagccgaattcaatatggat
gcgatggattatcatgctcacaaacccaagctggtggagattgttgtatccgcctacgag
acgctggcgaaagaaaaagatgtgattgtgattgaaggggctggcagcccggctgaaatt
aatctgcgggataatgatatcgtcaatatgggactggcagagttggttgacgcaccggtc
gttctgattggtgatattgacaagggtggcgtttttgcttcgatttatggtacaattatg
ttattggaaccggaagaacaaaaacgggtcaagggatttatcattaataaattccggggc
gatgtcgaattgttaaaaccgggcataaaaatgattgaagaaaaaattaatattccctgt
ctgggggttattccgtacaaacgatttgtgatcgatgatgaagatagtgttaccgaacgt
tttgacaaacataccgaagggttaattaccattggggtggtatatttgccgcatctgtct
aattttaccgattgtaccgcttttgagatgcaccccgatgttaatgtcgaatattaccgg
aatcagcgcgaactgcaactggctaatcccgatttattggtgattcccggcagtaaaaac
accatcgatgacacctgtcatgtgattgaaagcaagatgggtgaagaaatccgccgcatt
catgattgtggcgttccgattgtaggcgtttgtgggggatatcaactgttagggaaagaa
attcgtgatccattgcaggttgaatcgaccaagggtagtatcgccggtttgggattatta
aatattgtcacaacgatcggagcggaaaaacgaaccgttcggaccactggcaaagtccag
ggtgattttatgggaatggcattggttgatctggcagtggaaggttatgaaattcatatg
ggtgaaagtcaagcactggataatgcgaagccctttgcaattcttgccgatggtaccgtc
gatggggttattgccgaagatggcactgtcatgggaacctatctgcatggtatttttgat
aatgatgcgtttagagaaaaaattattgagaccttgcgcagtaaaaagaatctggccgcc
ggtcccgcggcgtttgattttaaagcctttaaaaatgagcaatatgaccttctggcggaa
acggtagaagcgagtttagatatgaaaaaaataatgggaattattggagaaatagaaaat
tga

DBGET integrated database retrieval system