KEGG   Acinetobacter wuhouensis: BEN71_13145Help
Entry
BEN71_13145       CDS       T05823                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BEN71_13145
Enzymes [BR:awu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BEN71_13145
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BEN71_13145
    1.1.1.-  
     BEN71_13145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh NAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AXQ22963
UniProt: A0A385C799
Position
complement(2608800..2609858)
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPQVLAGTVGIQVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIQVGQHVVVEPYIIADDVATGPNDNYHLSKDMNF
IGLGGRGGGLSEKIAVQRRWVHPISNDIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLTVIITELSAKRKEKALEAGVADYVLDPSQVDVVAEVMKITQD
RGVDVAFECSSVNKVMDTLVAAMKPTGVVVIVSIWSHPATINVHSVVMKELDIRGTIAYV
NDHQETIRLVEQGKINLEPFITQRIALDDLVAQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttatgacaagggtgacattcgtatagaagatattcctgaacca
caagttttggcaggaaccgtcgggatacaagtcgcttggtgtgggatttgcgggacagac
ttgcatgagtttatggaaggacctattttcataccaccatgtgggcatccacatcctatt
tcaggagagtcagcacctgtgaccatgggacatgaattttctggtgtggtttatgctgta
ggagaaggtgtggatgatattcaggttggacaacatgtggttgttgaaccctatatcatt
gctgatgatgtagcgacaggacccaatgacaattatcatttatctaaagatatgaatttt
attggtttaggtgggcgtggtggcggattgtctgaaaagattgcggtgcaacgccgttgg
gtacatccgatttccaatgatattcccttagatcaagctgcgttgattgagcctttatct
gttggtcatcacgcctatgttagaagtggtgcaaaggcgggagatattgcactggttggt
ggggcaggtccaatcggattgttattatccgccattttaaaagccaaaggtttgacagtt
attatcactgaactcagtgctaaacggaaagaaaaagcgctggaagcaggcgttgcggat
tatgtattagacccctcgcaagtcgatgtcgtggctgaagtgatgaaaatcacgcaggat
cgtggcgtggatgttgcttttgaatgcagcagtgtcaataaagtgatggataccttggtt
gctgccatgaaaccaacaggcgtcgtggtgatcgtgtcaatctggagtcatcccgcaacc
atcaatgtgcatagcgtggtgatgaaagaattggatatccgaggcactattgcttatgtg
aatgatcatcaggaaaccattcgtttggtggagcagggcaagattaatctagaaccgttt
attacccaacgaattgcactggatgatttggttgctcaaggatttgaaactttgattcac
aataacgagtcagcagttaaaattattgttcatccttga

DBGET integrated database retrieval system