KEGG   Acinetobacter wuhouensis: BEN71_14710Help
Entry
BEN71_14710       CDS       T05823                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
awu  Acinetobacter wuhouensis
Brite
KEGG Orthology (KO) [BR:awu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BEN71_14710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 CrgA
Motif
Other DBs
NCBI-ProteinID: AXQ23252
UniProt: A0A385C8M8
Position
complement(2953286..2954908)
Genome map
AA seq 540 aa AA seqDB search
MNSNLPPVSDSAQAQKAVKSTNVHVPTPKFFMPVFLTIIIATLIYIGVQLSADLAHVPAL
SLYSVILLATALFIALGFEFVNGFHDTANAVATVIYTNALPAPVAVMWAGFCNFLGVMVA
SGAVAYGIIALLPVELIMNVGSGAGFAMVFAMLIAAILWNLGTWFLGIPASSSHTLIGSI
LGVGIMNYILHSSSGASGVDMDQVLKVGKALLFSPLIGFAFAAVVFLLVKKIFKKQVELF
QPPEGNKPPPPLIRAILIFTCTGVSFAHGSNDGQKGMGLIMLILIGLVPLAYSLNKNLDQ
QHLQSFSQLSTQTATAIYAQHADIPDEKARVTITKFIQTKEINPEVVPALASLTDHLGER
VAKYGDLKDIPEAEVSSLRNDMYLSTTAFKRLDKAEQLPAMSTEQKKVVKEYRSNLDSFL
QYIPNWVKVAVALALGLGTMVGWKRIVVTVGERIGKHHMTYGQGMSAELVAMTTIAAADG
FGLPVSTTHVLNSAVAGTMVANKTGLNFATVKTILSAWIFTLPATICLSGALFWLLLKVF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaatttacctcccgtctcagattctgcacaagctcaaaaggctgtcaaatcg
acgaatgtgcatgttcctacaccgaaattttttatgccggtgtttttgacgatcattatt
gctaccctgatttatattggtgtgcaacttagtgcagatttagcacatgttcctgcttta
agtttatattctgtcattcttttagcgacagctttattcattgctttgggctttgagttt
gtcaatggtttccatgacacagccaatgctgtagcaaccgtaatttataccaatgcgcta
cctgcacctgttgcagtgatgtgggctggtttttgtaattttttaggggtaatggttgca
agtggtgcagtggcttatggcatcatcgcgttacttccggttgaactgattatgaatgtt
ggttcaggtgcaggattcgcaatggtttttgcgatgttaatcgctgccattctttggaac
ttaggtacatggttccttggtattccagcatcgagttcacataccttgattggttcgatt
ctgggtgtggggatcatgaactacattttgcattcatctagtggtgcaagtggtgtagac
atggatcaagttctcaaagtcggtaaggctttgttattctcacctttgattggttttgct
tttgctgcagttgtattcttattggttaaaaaaatctttaagaaacaagttgaattattc
caaccaccagaagggaataagccccctccacctttgattcgtgccattttgattttcacc
tgtacaggtgtgagttttgcgcatggttcaaatgatgggcaaaagggtatgggcttgatc
atgttgattttgatcggtttagtgccattggcttattctttgaataaaaacttagatcaa
caacatttacagtctttctcacaattgtctacacaaactgcgacagcgatttatgcgcaa
cacgcagatattccagatgaaaaagcacgtgtgacgattaccaaatttattcaaaccaaa
gagatcaacccagaagttgttcctgctttggcaagtttgacggatcatttaggtgaacgt
gttgccaagtatggtgatttaaaagatattccagaagctgaagtatcgtcattacgtaat
gatatgtacttgagtacgactgcttttaaacgtttagataaagcggaacaacttcctgcc
atgtctacagaacaaaagaaagtggtaaaagagtaccgcagcaacttagattcgttccta
caatatattccaaactgggtgaaagttgcagttgcattggcactcggtttaggaacaatg
gtgggttggaagcgtattgttgtgacagtgggtgagcgtattggtaagcatcacatgact
tatggtcaagggatgtctgctgagttggttgcaatgacgacaattgcagcagcggatggt
tttggtttgcctgtatcaacaacgcatgttttaaactctgcggttgcaggtaccatggtt
gccaataaaacaggtctaaatttcgcgacagtgaaaacaattctttctgcttggatcttt
acattacctgcgacgatttgtttatctggtgcgttattctggttgttattgaaagtgttc
taa

DBGET integrated database retrieval system