KEGG   Acinetobacter wuhouensis: BEN71_15305Help
Entry
BEN71_15305       CDS       T05823                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00640  Propanoate metabolism
awu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BEN71_15305 (acnD)
Enzymes [BR:awu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BEN71_15305 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AXQ23354
UniProt: A0A385C710
Position
complement(3072356..3074971)
Genome map
AA seq 871 aa AA seqDB search
MNNNYRKPLQGTQLEYFDVRQAVEDIQPGAYAKLPYTSKVLAEQLVRRCDPAILEQSLKE
LINRKQDHDFPWYPARVVCHDILGQTALVDLAGLRDAIADQGGDPSKVNPVVPTQLIVDH
SLAVEYGGFDPDAFEKNRAVEDRRNEDRFHFIEWTKTAFENVDVIPAGNGIMHQINLEKM
SPVVQNREGVAFPDTCVGTDSHTPHTDALGVISIGVGGLEAENVMLGRASWMRLPDIIGV
EFVGQRQAGITATDIVLALTEFLRKERVVGAYLEFFGEGADSMSVGDRATISNMTPEYGA
TAAMFYIDQNTIDYLTLTGREADQVKLVETYAKEIGLWASDMKQAEYPRVLRFDLSTVTR
NIAGPSNPHARVSTADLKAKGIAGNLDAARAQEAEGLMPDGAVIIAAITSCTNTSNPRNT
VAAGLLARKANELGLVRKPWVKSSFAPGSKAAALYLEEAGVLGDLEKLGFGIVAYACTTC
NGMSGALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTI
RFDIETDSLGNDKDGNPIYLKDIWPSDEEIDALVKVAVKPEQFKKVYIPMFDLGERVQAA
SPLYDWRPQSTYIRRPPYWEGALAAPRTLANMRPLAILPDNITTDHLSPSNAILMDSAAG
EYLHKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVVRSDGTIKQGSKARVEPEG
EVMRMWEAIETYMNRKQPLIIIAGKDYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTN
LVGMGVLPLEFKAGTDRKTLKLDGTELYSVIGNIAPRSTLTLVIERSTADGQNEIVKVPV
TCRLDTEEEVHVYEAGGVLQRFAQDFLEGNV
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaattatcgcaaaccactgcaaggtacccagctcgaatacttcgatgtgcgt
caagccgttgaagacatccagccaggcgcatacgcgaaacttccatacacttcaaaagta
ttggctgaacagttagtccgtcgctgtgacccagccattctcgaacaatctttaaaagaa
ctgattaaccgtaaacaagaccatgattttccttggtatcctgcacgtgtggtgtgccat
gacattctcggacaaactgcattggttgaccttgcaggtctgcgtgatgcgattgccgac
caaggtggtgatccttcaaaagtaaacccagttgtaccaacccagttgatcgtagatcac
tctttggcagtggaatacggtggttttgacccagatgcatttgagaaaaaccgtgctgtg
gaagaccgtcgtaacgaagaccgtttccacttcatcgaatggactaaaactgcgtttgaa
aatgtcgacgtgatccctgcgggtaacggcatcatgcaccagatcaacttggagaaaatg
tctccagtggtgcaaaaccgtgaaggtgtggcattccctgatacttgtgtaggtacagat
tctcatacaccacatactgatgcgcttggtgtgatctcaattggtgtcggaggactcgaa
gctgaaaatgtaatgttgggtcgagcatcttggatgcgtcttccagatattatcggtgta
gaatttgttggtcagcgtcaagcaggcattaccgcaacagatatcgtattggcattgaca
gaattcttgcgtaaagaacgtgtggtgggtgcatatttagaattctttggtgaaggtgca
gacagcatgtcagtgggtgatcgtgccacgatttccaacatgactcctgaatatggcgca
actgcggcaatgttctacattgatcagaacaccattgattatttaacactgacaggtcgt
gaagcagatcaggttaaacttgttgaaacctatgccaaagaaatcggtctttgggcatcg
gacatgaaacaagcggaatatccacgtgtacttcgtttcgatctttcaactgtaacccgt
aatattgcaggtccatcaaacccacatgctcgtgtatcaacagcagatttaaaagccaaa
ggcattgcaggtaatttagacgcagctcgtgcgcaagaagctgaaggtttaatgccagat
ggtgctgtgatcattgcagcgattacgtcttgtaccaatacttcgaatccacgtaatacc
gttgccgcaggcttgttggcgcgtaaagccaatgaacttggtttagtgcgtaaaccttgg
gtgaaatcatcatttgcaccaggttctaaagcagcagctttgtatcttgaagaagcaggc
gtattgggtgatcttgagaagcttggtttcggtattgtggcgtatgcctgtaccacatgt
aacggtatgtcaggtgcgttagatcctgtaattcaacaagaaattattgaccgtgacctg
tacgcaactgcggtactgtcaggtaaccgtaactttgatggtcgtattcatccttatgca
aagcaagcgttcttggcttctccaccgttggttgtggcgtatgcgattgcaggaacaatc
cgttttgacatcgaaacagattcattgggcaatgacaaagacggtaatccgatttactta
aaagacatttggccatcggacgaagaaattgatgctctggtaaaagttgctgttaaacct
gaacagttcaagaaagtgtatatcccaatgtttgatttgggtgagcgtgtacaggctgcg
agtccattgtatgactggcgtccgcaaagtacctatatccgccgtccgccgtattgggaa
ggtgctttggctgcgccacgtactttggcgaatatgcgtccgcttgcgattcttcctgac
aatatcacgacagatcacttgtcaccatcgaatgcgatcttgatggattcggcagcaggt
gaatatcttcacaaaatgggcgtgcctgaggaagacttcaactcttacgcaacgcaccgt
ggtgaccatttaactgcgcaacgtgcaacatttgcaaacccgaaactgttcaatgaaatg
gtggttcgctctgacggtacgatcaagcaaggttctaaagcacgtgttgagcctgagggc
gaagtgatgcgtatgtgggaagcgatcgaaacttatatgaatcgtaagcaaccgctgatc
atcattgcaggtaaagattatggtcagggttctagccgtgactgggctgcaaaaggtgtg
cgtcttgctggtgttgaagtgattgttgcagaaggttttgagcgtattcaccgtactaac
cttgtaggtatgggggtattaccgcttgagtttaaagcaggtacagaccgtaagacgtta
aagcttgatggtactgagttgtatagcgtgattggtaatattgcgccgcgttcgacttta
actttggtgatcgagcgttcgactgctgatggtcaaaatgagatcgtgaaagtgcctgta
acctgtcgtttggataccgaagaagaagtgcatgtgtatgaagcgggtggtgtgttgcaa
cgctttgcacaggatttcttggaagggaatgtttaa

DBGET integrated database retrieval system